BLAST (blastp) functionnal test

This is a test of the BLAST blastp protein similarity search (CNRS IBCP) service.
Test filesDownload the files for this test
Test runRun test now
Support reference#92-263
run a BLAST search with a known sequence
check that the result is a BLAST file with the sequence in the list
Show/hide recent test logs
view log 3 weeks agoPASSED

Test began: 2010-08-16 05:05:59 Test ended: 2010-08-16 05:12:44 Result : Test passedDownload this log...
view log 3 weeks agoPASSED

Test began: 2010-08-16 02:10:14 Test ended: 2010-08-16 02:17:04 Result : Test passedDownload this log...
view log 4 weeks agoPASSED

Test began: 2010-08-06 14:54:23 Test ended: 2010-08-06 15:01:18 Result : Test passedDownload this log...
view log 2 months agoPASSED

Test began: 2010-07-01 09:42:53 Test ended: 2010-07-01 09:49:18 Result : Test passedDownload this log...
view log 2 months agoPASSED

Test began: 2010-06-21 22:20:03 Test ended: 2010-06-21 22:26:42 Result : Test passedDownload this log...
view log 3 months agoPASSED

Test began: 2010-06-11 10:51:48 Test ended: 2010-06-11 10:58:19 Result : Test passedDownload this log...
view log 3 months agoPASSED

Test began: 2010-06-05 09:34:15 Test ended: 2010-06-05 09:40:50 Result : Test passedDownload this log...
view log 3 months agoFAILED

Test began: 2010-05-29 09:59:24 Test ended: 2010-05-29 10:00:40 Result : Test failure ------ stderr and stdout follow ------ Traceback (most recent call last): File "./gbiowstest-blastp.py", line 65, inDownload this log...resp = port.submitBlast(req) File "/Library/WebServer.embraceregistry/Documents/sites/all/modules/ws_registry/registry/92/263/package/Blast_Service_client.py", line 38, in submitBlast self.binding.Send(None, None, request, soapaction="urn:BlastWS.wsdl#submitBlast", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw) File "build/bdist.macosx-10.5-i386/egg/ZSI/client.py", line 291, in Send File "/System/Library/Frameworks/Python.framework/Versions/2.5/lib/python2.5/httplib.py", line 679, in connect raise socket.error, msg socket.error: (60, 'Operation timed out')
view log 3 months agoFAILED

Test began: 2010-05-22 22:32:16 Test ended: 2010-05-22 22:33:31 Result : Test failure ------ stderr and stdout follow ------ Traceback (most recent call last): File "./gbiowstest-blastp.py", line 65, inDownload this log...resp = port.submitBlast(req) File "/Library/WebServer.embraceregistry/Documents/sites/all/modules/ws_registry/registry/92/263/package/Blast_Service_client.py", line 38, in submitBlast self.binding.Send(None, None, request, soapaction="urn:BlastWS.wsdl#submitBlast", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw) File "build/bdist.macosx-10.5-i386/egg/ZSI/client.py", line 291, in Send File "/System/Library/Frameworks/Python.framework/Versions/2.5/lib/python2.5/httplib.py", line 679, in connect raise socket.error, msg socket.error: (60, 'Operation timed out')
view log 4 months agoPASSED

Test began: 2010-05-15 15:20:40 Test ended: 2010-05-15 15:27:11 Result : Test passedDownload this log...
This test consists of the following files:
__MACOSX/
._gbiowstest-blastp.py (binary file)
benchy_seq001.seq
>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009) MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG LAARRRCCRGYLLTRRYPWKGLCAGCRRWV
Blast_Service_client.py
##################################################
# file: Blast_Service_client.py
#
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
# /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/BlastWS.wsdl
#
##################################################
import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI
# Locator
class Blast_ServiceLocator:
BlastPort_address = "http://gbio.ibcp.fr:8090/Blast_Service"
def getBlastPortAddress(self):
return Blast_ServiceLocator.BlastPort_address
def getBlastPort(self, url=None, **kw):
return BlastBindingSOAP(url or Blast_ServiceLocator.BlastPort_address, **kw)
# Methods
class BlastBindingSOAP:
def __init__(self, url, **kw):
kw.setdefault("readerclass", None)
kw.setdefault("writerclass", None)
# no resource properties
self.binding = client.Binding(url=url, **kw)
# no ws-addressing
# op: submitBlast
def submitBlast(self, request, **kw):
if isinstance(request, submitBlastRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:BlastWS.wsdl#submitBlast", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=submitBlastResponse.typecode.ofwhat, pyclass=submitBlastResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: checkStatusBlast
def checkStatusBlast(self, request, **kw):
if isinstance(request, checkStatusBlastRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:BlastWS.wsdl#checkStatusBlast", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=checkStatusBlastResponse.typecode.ofwhat, pyclass=checkStatusBlastResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: getResultsBlast
def getResultsBlast(self, request, **kw):
if isinstance(request, getResultsBlastRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:BlastWS.wsdl#getResultsBlast", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=getResultsBlastResponse.typecode.ofwhat, pyclass=getResultsBlastResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: cancelResultsBlast
def cancelResultsBlast(self, request, **kw):
if isinstance(request, cancelBlastRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:BlastWS.wsdl#cancelResultsBlast", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=cancelBlastResponse.typecode.ofwhat, pyclass=cancelBlastResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
class submitBlastRequest:
def __init__(self, **kw):
"""Keyword parameters:
Sequence -- part Sequence
SeqDatabase -- part SeqDatabase
"""
self._Sequence = kw.get("Sequence")
self._SeqDatabase = kw.get("SeqDatabase")
submitBlastRequest.typecode = Struct(pname=("urn:Blast_Service","submitBlast"), ofwhat=[ZSI.TC.String(pname="Sequence", aname="_Sequence", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="SeqDatabase", aname="_SeqDatabase", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitBlastRequest, encoded="urn:Blast_Service")
class submitBlastResponse:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
submitBlastResponse.typecode = Struct(pname=("urn:Blast_Service","submitBlastResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitBlastResponse, encoded="urn:Blast_Service")
class checkStatusBlastRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
checkStatusBlastRequest.typecode = Struct(pname=("urn:Blast_Service","checkStatusBlast"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusBlastRequest, encoded="urn:Blast_Service")
class checkStatusBlastResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
checkStatusBlastResponse.typecode = Struct(pname=("urn:Blast_Service","checkStatusBlastResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusBlastResponse, encoded="urn:Blast_Service")
class getResultsBlastRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
getResultsBlastRequest.typecode = Struct(pname=("urn:Blast_Service","getResultsBlast"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsBlastRequest, encoded="urn:Blast_Service")
class getResultsBlastResponse:
def __init__(self, **kw):
"""Keyword parameters:
SeqSimilar -- part SeqSimilar
Logout -- part Logout
"""
self._SeqSimilar = kw.get("SeqSimilar")
self._Logout = kw.get("Logout")
getResultsBlastResponse.typecode = Struct(pname=("urn:Blast_Service","getResultsBlastResponse"), ofwhat=[ZSI.TC.String(pname="SeqSimilar", aname="_SeqSimilar", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="Logout", aname="_Logout", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsBlastResponse, encoded="urn:Blast_Service")
class cancelBlastRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
cancelBlastRequest.typecode = Struct(pname=("urn:Blast_Service","cancelResultsBlast"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelBlastRequest, encoded="urn:Blast_Service")
class cancelBlastResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
cancelBlastResponse.typecode = Struct(pname=("urn:Blast_Service","cancelResultsBlastResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelBlastResponse, encoded="urn:Blast_Service")
Blast_Service_client.pyc (binary file)
Blast_Service_types.py
################################################## # file: Blast_Service_types.py # # schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule" # /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/BlastWS.wsdl # ################################################## import ZSI import ZSI.TCcompound from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED
gbiowstest-blastp.py
#!/usr/bin/env python
# ================================================================================
#
# COPYRIGHT NOTICE
#
# Centre National de la Recherche Scientifique
# CNRS
#
# Institut de Biologie et Chimie des Proteines
# IBCP CNRS UMR 5086
# 7 passage du Vercors
# 69007 Lyon, FRANCE
#
# This software/database is covered by copyright of CNRS IBCP
# All rights reserved. Reproduction and usage of this software/database are
# strictly restricted, and need a prior written permission from CNRS IBCP
# (see "Contact" below).
#
# CNRS IBCP do not and cannot warrant the performance or results that
# may be obtained by using this software or data. CNRS IBCP disclaim all
# warranties, express or implied, including warranties of performance,
# merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date: 18/11/2008
#
# $Revision: 1.0 $
#
# File Description:
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date Name Description of modification
# ------- ---------- -----------------------------------------------------
#
# ================================================================================
import sys
import time
from Blast_Service_client import *
fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.blast'
ret = 0
# get a port proxy instance
loc = Blast_ServiceLocator()
port = loc.getBlastPort()
###
# submit a new request
# create
req = submitBlastRequest()
fp_input = open (fn_input, 'r')
req._Sequence = fp_input.read()
req._SeqDatabase = "swiss-prot"
# call the remote method
resp = port.submitBlast(req)
jobid = resp._JobId
#print jobid
if not jobid:
ret = 1
###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusBlastRequest()
req._JobId = jobid
while status not in ('done','aborted'):
time.sleep(2)
resp = port.checkStatusBlast(req)
status = resp._Status
#print status
if status != 'done':
ret = 1
###
# get results
req = getResultsBlastRequest()
req._JobId = jobid
resp = port.getResultsBlast(req)
# write result
#open(fn_control,'w').write(resp._SeqSimilar)
# check result
if 'RBTR_KLEAE' not in resp._SeqSimilar:
ret = 1
# print "wooohh"
#print ret
sys.exit (ret)
»
- Login to post comments