FASTA functionnal test

>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009)
MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR
SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ
VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR
RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG
LAARRRCCRGYLLTRRYPWKGLCAGCRRWV

##################################################
# file: Fasta_Service_client.py
# 
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#     /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/FastaWS.wsdl
# 
##################################################


import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI

# Locator
class Fasta_ServiceLocator:
    FastaPort_address = "http://gbio.ibcp.fr:8090/Fasta_Service"
    def getFastaPortAddress(self):
        return Fasta_ServiceLocator.FastaPort_address
    def getFastaPort(self, url=None, **kw):
        return FastaBindingSOAP(url or Fasta_ServiceLocator.FastaPort_address, **kw)

# Methods
class FastaBindingSOAP:
    def __init__(self, url, **kw):
        kw.setdefault("readerclass", None)
        kw.setdefault("writerclass", None)
        # no resource properties
        self.binding = client.Binding(url=url, **kw)
        # no ws-addressing

    # op: submitFasta
    def submitFasta(self, request, **kw):
        if isinstance(request, submitFastaRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#submitFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=submitFastaResponse.typecode.ofwhat, pyclass=submitFastaResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: checkStatusFasta
    def checkStatusFasta(self, request, **kw):
        if isinstance(request, checkStatusFastaRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#checkStatusFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=checkStatusFastaResponse.typecode.ofwhat, pyclass=checkStatusFastaResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: getResultsFasta
    def getResultsFasta(self, request, **kw):
        if isinstance(request, getResultsFastaRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#getResultsFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=getResultsFastaResponse.typecode.ofwhat, pyclass=getResultsFastaResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: cancelFasta
    def cancelFasta(self, request, **kw):
        if isinstance(request, cancelFastaRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#cancelFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=cancelFastaResponse.typecode.ofwhat, pyclass=cancelFastaResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

class submitFastaRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        Sequence -- part Sequence
        SeqDatabase -- part SeqDatabase
        """
        self._Sequence =  kw.get("Sequence")
        self._SeqDatabase =  kw.get("SeqDatabase")
submitFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","submitFasta"), ofwhat=[ZSI.TC.String(pname="Sequence", aname="_Sequence", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="SeqDatabase", aname="_SeqDatabase", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitFastaRequest, encoded="urn:Fasta_Service")

class submitFastaResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
submitFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","submitFastaResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitFastaResponse, encoded="urn:Fasta_Service")

class checkStatusFastaRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
checkStatusFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","checkStatusFasta"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusFastaRequest, encoded="urn:Fasta_Service")

class checkStatusFastaResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
checkStatusFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","checkStatusFastaResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusFastaResponse, encoded="urn:Fasta_Service")

class getResultsFastaRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
getResultsFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","getResultsFasta"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsFastaRequest, encoded="urn:Fasta_Service")

class getResultsFastaResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        SeqSimilar -- part SeqSimilar
        Logout -- part Logout
        """
        self._SeqSimilar =  kw.get("SeqSimilar")
        self._Logout =  kw.get("Logout")
getResultsFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","getResultsFastaResponse"), ofwhat=[ZSI.TC.String(pname="SeqSimilar", aname="_SeqSimilar", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="Logout", aname="_Logout", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsFastaResponse, encoded="urn:Fasta_Service")

class cancelFastaRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
cancelFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","cancelFasta"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelFastaRequest, encoded="urn:Fasta_Service")

class cancelFastaResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
cancelFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","cancelFastaResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelFastaResponse, encoded="urn:Fasta_Service")

##################################################
# file: Fasta_Service_types.py
#
# schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#    /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/FastaWS.wsdl
#
##################################################

import ZSI
import ZSI.TCcompound
from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED

#!/usr/bin/env python
# ================================================================================
#
#                             COPYRIGHT NOTICE
#
#                Centre National de la Recherche Scientifique
#                                   CNRS
#
#                Institut de Biologie et Chimie des Proteines
#                             IBCP CNRS UMR 5086
#                            7 passage du Vercors
#                             69007 Lyon, FRANCE
#
#  This software/database is covered by copyright of CNRS IBCP
#  All rights reserved. Reproduction and usage of this software/database are 
#  strictly restricted, and need a prior written permission from CNRS IBCP
#  (see "Contact" below).
#
#  CNRS IBCP do not and cannot warrant the performance or results that
#  may be obtained by using this software or data. CNRS IBCP disclaim all
#  warranties, express or implied, including warranties of performance,
#  merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date:   18/11/2008
#
# $Revision: 1.0 $
#
# File Description: 
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date     Name        Description of modification
# -------  ----------  -----------------------------------------------------
#
# ================================================================================
import sys
import time
from Fasta_Service_client import *

fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.Fasta'
ret = 0

# get a port proxy instance
loc = Fasta_ServiceLocator()
port = loc.getFastaPort()

###
# submit a new request
# create
req = submitFastaRequest()
fp_input = open (fn_input, 'r')
req._Sequence = fp_input.read()
req._SeqDatabase = "swiss-prot"


# call the remote method
resp = port.submitFasta(req)
jobid = resp._JobId
#print jobid
if not jobid:
	ret = 1

###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusFastaRequest()
req._JobId = jobid
while status not in ('done','aborted'):
	time.sleep(2) 
	resp = port.checkStatusFasta(req)
	status = resp._Status
	#print status
if status != 'done':
	ret = 1

###
# get results
req = getResultsFastaRequest()
req._JobId = jobid
resp = port.getResultsFasta(req)

# write result
#open(fn_control,'w').write(resp._SeqSimilar)

# check result
if 'RBTR_KLEAE' not in resp._SeqSimilar:
	ret = 1
#	print "wooohh"

#print ret
sys.exit (ret)