FASTA functionnal test

This is a test of the FASTA protein similarity search (CNRS IBCP) service.
Test filesDownload the files for this test
Test runRun test now
Support reference#264-265
run a FASTA search with a known sequence
check that the result is a FASTA file with the sequence in the list
Show/hide recent test logs
view log 5 days agoPASSED

Test began: 2012-02-01 13:02:18 Test ended: 2012-02-01 13:02:53 Result : Test passedDownload this log...
view log 3 weeks agoPASSED

Test began: 2012-01-13 12:43:14 Test ended: 2012-01-13 12:43:50 Result : Test passedDownload this log...
view log 4 weeks agoPASSED

Test began: 2012-01-10 12:42:44 Test ended: 2012-01-10 12:43:27 Result : Test passedDownload this log...
view log 1 month agoPASSED

Test began: 2012-01-06 00:57:39 Test ended: 2012-01-06 00:58:24 Result : Test passedDownload this log...
view log 1 month agoPASSED

Test began: 2012-01-02 22:32:27 Test ended: 2012-01-02 22:33:01 Result : Test passedDownload this log...
view log 1 month agoPASSED

Test began: 2012-01-01 15:20:12 Test ended: 2012-01-01 15:20:46 Result : Test passedDownload this log...
view log 2 months agoPASSED

Test began: 2011-12-22 17:05:20 Test ended: 2011-12-22 17:06:03 Result : Test passedDownload this log...
view log 2 months agoFAILED

Test began: 2011-12-17 14:21:15 Test ended: 2011-12-17 14:39:17 Result : Test failure ------ stderr and stdout follow ------ Traceback (most recent call last): File "./gbiowstest-fasta.py", line 79, inDownload this log...resp = port.checkStatusFasta(req) File "/Library/WebServer.embraceregistry/Documents/sites/all/modules/ws_registry/registry/264/265/package/Fasta_Service_client.py", line 49, in checkStatusFasta self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#checkStatusFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw) File "build/bdist.macosx-10.5-i386/egg/ZSI/client.py", line 291, in Send File "/System/Library/Frameworks/Python.framework/Versions/2.5/lib/python2.5/httplib.py", line 679, in connect raise socket.error, msg socket.error: (60, 'Operation timed out')
view log 2 months agoPASSED

Test began: 2011-12-14 16:48:53 Test ended: 2011-12-14 16:49:24 Result : Test passedDownload this log...
view log 2 months agoPASSED

Test began: 2011-11-25 05:18:27 Test ended: 2011-11-25 05:19:01 Result : Test passedDownload this log...
This test consists of the following files:
__MACOSX/
._gbiowstest-fasta.py (binary file)
benchy_seq001.seq
>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009) MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG LAARRRCCRGYLLTRRYPWKGLCAGCRRWV
Fasta_Service_client.py
##################################################
# file: Fasta_Service_client.py
#
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
# /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/FastaWS.wsdl
#
##################################################
import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI
# Locator
class Fasta_ServiceLocator:
FastaPort_address = "http://gbio.ibcp.fr:8090/Fasta_Service"
def getFastaPortAddress(self):
return Fasta_ServiceLocator.FastaPort_address
def getFastaPort(self, url=None, **kw):
return FastaBindingSOAP(url or Fasta_ServiceLocator.FastaPort_address, **kw)
# Methods
class FastaBindingSOAP:
def __init__(self, url, **kw):
kw.setdefault("readerclass", None)
kw.setdefault("writerclass", None)
# no resource properties
self.binding = client.Binding(url=url, **kw)
# no ws-addressing
# op: submitFasta
def submitFasta(self, request, **kw):
if isinstance(request, submitFastaRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#submitFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=submitFastaResponse.typecode.ofwhat, pyclass=submitFastaResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: checkStatusFasta
def checkStatusFasta(self, request, **kw):
if isinstance(request, checkStatusFastaRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#checkStatusFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=checkStatusFastaResponse.typecode.ofwhat, pyclass=checkStatusFastaResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: getResultsFasta
def getResultsFasta(self, request, **kw):
if isinstance(request, getResultsFastaRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#getResultsFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=getResultsFastaResponse.typecode.ofwhat, pyclass=getResultsFastaResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: cancelFasta
def cancelFasta(self, request, **kw):
if isinstance(request, cancelFastaRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:FastaWS.wsdl#cancelFasta", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=cancelFastaResponse.typecode.ofwhat, pyclass=cancelFastaResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
class submitFastaRequest:
def __init__(self, **kw):
"""Keyword parameters:
Sequence -- part Sequence
SeqDatabase -- part SeqDatabase
"""
self._Sequence = kw.get("Sequence")
self._SeqDatabase = kw.get("SeqDatabase")
submitFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","submitFasta"), ofwhat=[ZSI.TC.String(pname="Sequence", aname="_Sequence", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="SeqDatabase", aname="_SeqDatabase", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitFastaRequest, encoded="urn:Fasta_Service")
class submitFastaResponse:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
submitFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","submitFastaResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitFastaResponse, encoded="urn:Fasta_Service")
class checkStatusFastaRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
checkStatusFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","checkStatusFasta"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusFastaRequest, encoded="urn:Fasta_Service")
class checkStatusFastaResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
checkStatusFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","checkStatusFastaResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusFastaResponse, encoded="urn:Fasta_Service")
class getResultsFastaRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
getResultsFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","getResultsFasta"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsFastaRequest, encoded="urn:Fasta_Service")
class getResultsFastaResponse:
def __init__(self, **kw):
"""Keyword parameters:
SeqSimilar -- part SeqSimilar
Logout -- part Logout
"""
self._SeqSimilar = kw.get("SeqSimilar")
self._Logout = kw.get("Logout")
getResultsFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","getResultsFastaResponse"), ofwhat=[ZSI.TC.String(pname="SeqSimilar", aname="_SeqSimilar", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="Logout", aname="_Logout", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsFastaResponse, encoded="urn:Fasta_Service")
class cancelFastaRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
cancelFastaRequest.typecode = Struct(pname=("urn:Fasta_Service","cancelFasta"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelFastaRequest, encoded="urn:Fasta_Service")
class cancelFastaResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
cancelFastaResponse.typecode = Struct(pname=("urn:Fasta_Service","cancelFastaResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelFastaResponse, encoded="urn:Fasta_Service")
Fasta_Service_client.pyc (binary file)
Fasta_Service_types.py
################################################## # file: Fasta_Service_types.py # # schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule" # /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/FastaWS.wsdl # ################################################## import ZSI import ZSI.TCcompound from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED
gbiowstest-fasta.py
#!/usr/bin/env python
# ================================================================================
#
# COPYRIGHT NOTICE
#
# Centre National de la Recherche Scientifique
# CNRS
#
# Institut de Biologie et Chimie des Proteines
# IBCP CNRS UMR 5086
# 7 passage du Vercors
# 69007 Lyon, FRANCE
#
# This software/database is covered by copyright of CNRS IBCP
# All rights reserved. Reproduction and usage of this software/database are
# strictly restricted, and need a prior written permission from CNRS IBCP
# (see "Contact" below).
#
# CNRS IBCP do not and cannot warrant the performance or results that
# may be obtained by using this software or data. CNRS IBCP disclaim all
# warranties, express or implied, including warranties of performance,
# merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date: 18/11/2008
#
# $Revision: 1.0 $
#
# File Description:
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date Name Description of modification
# ------- ---------- -----------------------------------------------------
#
# ================================================================================
import sys
import time
from Fasta_Service_client import *
fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.Fasta'
ret = 0
# get a port proxy instance
loc = Fasta_ServiceLocator()
port = loc.getFastaPort()
###
# submit a new request
# create
req = submitFastaRequest()
fp_input = open (fn_input, 'r')
req._Sequence = fp_input.read()
req._SeqDatabase = "swiss-prot"
# call the remote method
resp = port.submitFasta(req)
jobid = resp._JobId
#print jobid
if not jobid:
ret = 1
###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusFastaRequest()
req._JobId = jobid
while status not in ('done','aborted'):
time.sleep(2)
resp = port.checkStatusFasta(req)
status = resp._Status
#print status
if status != 'done':
ret = 1
###
# get results
req = getResultsFastaRequest()
req._JobId = jobid
resp = port.getResultsFasta(req)
# write result
#open(fn_control,'w').write(resp._SeqSimilar)
# check result
if 'RBTR_KLEAE' not in resp._SeqSimilar:
ret = 1
# print "wooohh"
#print ret
sys.exit (ret)
»
- Login to post comments