Functional test

>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009)
MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR
SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ
VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR
RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG
LAARRRCCRGYLLTRRYPWKGLCAGCRRWV

> Unknow
              .         .         .         .         .
1    MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGY   50
     ___EEEEE_______HHHHHHHHH____HHHHHHHHHHHHHHHHHHHH__

              .         .         .         .         .
51   AINRQASMLRSKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIIT  100
     _HHHHHHHHHHHH_EEEEEEEE_________HHHHHHHHHHHH___EEEE

              .         .         .         .         .
101  CTRRRPELEIEAVKAMLSWQVDWVVATGATNPDKISALCQQAGVPTVNLD  150
     E___HHHHHHHHHHHHHHHHHHHEEEE_______HHHHHHHH____EEEE

              .         .         .         .         .
151  LPGSLSPSVISDNYGGAKALTHKILANSARRRGELAPLTFIGGRRATITP  200
     ________________HHHHHHHHHHH_HHHHHH__________EEE___

              .         .         .         .         .
201  ASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSGLAARRRCCRG  250
     _HHHHHHHHHHH____HHHHHHH_HHHHHHHHHHHHH___HHHHHHH___

              .         .
251  YLLTRRYPWKGLCAGCRRWV                                270
     _EEE________________

#!/usr/bin/env python
# ================================================================================
#
#                             COPYRIGHT NOTICE
#
#                Centre National de la Recherche Scientifique
#                                   CNRS
#
#                Institut de Biologie et Chimie des Proteines
#                             IBCP CNRS UMR 5086
#                            7 passage du Vercors
#                             69007 Lyon, FRANCE
#
#  This software/database is covered by copyright of CNRS IBCP
#  All rights reserved. Reproduction and usage of this software/database are 
#  strictly restricted, and need a prior written permission from CNRS IBCP
#  (see "Contact" below).
#
#  CNRS IBCP do not and cannot warrant the performance or results that
#  may be obtained by using this software or data. CNRS IBCP disclaim all
#  warranties, express or implied, including warranties of performance,
#  merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date:   18/11/2008
#
# $Revision: 1.0 $
#
# File Description: 
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date     Name        Description of modification
# -------  ----------  -----------------------------------------------------
#
# ================================================================================
import sys
import time
from Predator_Service_client import *

fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.Predator'
ret = 0

# get a port proxy instance
loc = Predator_ServiceLocator()
port = loc.getPredatorPort()

###
# submit a new request
# create
req = submitPredatorRequest()
fp_input = open (fn_input, 'r')
req._Sequences = fp_input.read()

# call the remote method
resp = port.submitPredator(req)
jobid = resp._JobId
#print jobid
if not jobid:
	ret = 1

###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusPredatorRequest()
req._JobId = jobid
while status not in ('done','aborted'):
	time.sleep(2) 
	resp = port.checkStatusPredator(req)
	status = resp._Status
	#print status
if status != 'done':
	ret = 1

###
# get results
req = getResultsPredatorRequest()
req._JobId = jobid
resp = port.getResultsPredator(req)

# write result
#open(fn_control,'w').write(resp._SecStructure)

#compare result with ref
resultcontrol = open(fn_control, 'r').read()
if resp._SecStructure != resultcontrol:
	ret = 1
	#print "wooohh"

#print ret
sys.exit (ret)

##################################################
# file: Predator_Service_client.py
# 
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#     /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/PredatorWS.wsdl
# 
##################################################


import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI

# Locator
class Predator_ServiceLocator:
    PredatorPort_address = "http://gbio.ibcp.fr:8090/Predator_Service"
    def getPredatorPortAddress(self):
        return Predator_ServiceLocator.PredatorPort_address
    def getPredatorPort(self, url=None, **kw):
        return PredatorBindingSOAP(url or Predator_ServiceLocator.PredatorPort_address, **kw)

# Methods
class PredatorBindingSOAP:
    def __init__(self, url, **kw):
        kw.setdefault("readerclass", None)
        kw.setdefault("writerclass", None)
        # no resource properties
        self.binding = client.Binding(url=url, **kw)
        # no ws-addressing

    # op: submitPredator
    def submitPredator(self, request, **kw):
        if isinstance(request, submitPredatorRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PredatorWS.wsdl#submitPredator", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=submitPredatorResponse.typecode.ofwhat, pyclass=submitPredatorResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: checkStatusPredator
    def checkStatusPredator(self, request, **kw):
        if isinstance(request, checkStatusPredatorRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PredatorWS.wsdl#checkStatusPredator", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=checkStatusPredatorResponse.typecode.ofwhat, pyclass=checkStatusPredatorResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: getResultsPredator
    def getResultsPredator(self, request, **kw):
        if isinstance(request, getResultsPredatorRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PredatorWS.wsdl#getResultsPredator", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=getResultsPredatorResponse.typecode.ofwhat, pyclass=getResultsPredatorResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: cancelPredator
    def cancelPredator(self, request, **kw):
        if isinstance(request, cancelPredatorRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PredatorWS.wsdl#cancelPredator", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=cancelPredatorResponse.typecode.ofwhat, pyclass=cancelPredatorResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

class submitPredatorRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        Sequences -- part Sequences
        """
        self._Sequences =  kw.get("Sequences")
submitPredatorRequest.typecode = Struct(pname=("urn:Predator_Service","submitPredator"), ofwhat=[ZSI.TC.String(pname="Sequences", aname="_Sequences", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitPredatorRequest, encoded="urn:Predator_Service")

class submitPredatorResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
submitPredatorResponse.typecode = Struct(pname=("urn:Predator_Service","submitPredatorResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitPredatorResponse, encoded="urn:Predator_Service")

class checkStatusPredatorRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
checkStatusPredatorRequest.typecode = Struct(pname=("urn:Predator_Service","checkStatusPredator"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusPredatorRequest, encoded="urn:Predator_Service")

class checkStatusPredatorResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
checkStatusPredatorResponse.typecode = Struct(pname=("urn:Predator_Service","checkStatusPredatorResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusPredatorResponse, encoded="urn:Predator_Service")

class getResultsPredatorRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
getResultsPredatorRequest.typecode = Struct(pname=("urn:Predator_Service","getResultsPredator"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsPredatorRequest, encoded="urn:Predator_Service")

class getResultsPredatorResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        SecStructure -- part SecStructure
        Logout -- part Logout
        """
        self._SecStructure =  kw.get("SecStructure")
        self._Logout =  kw.get("Logout")
getResultsPredatorResponse.typecode = Struct(pname=("urn:Predator_Service","getResultsPredatorResponse"), ofwhat=[ZSI.TC.String(pname="SecStructure", aname="_SecStructure", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="Logout", aname="_Logout", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsPredatorResponse, encoded="urn:Predator_Service")

class cancelPredatorRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
cancelPredatorRequest.typecode = Struct(pname=("urn:Predator_Service","cancelPredator"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelPredatorRequest, encoded="urn:Predator_Service")

class cancelPredatorResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
cancelPredatorResponse.typecode = Struct(pname=("urn:Predator_Service","cancelPredatorResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelPredatorResponse, encoded="urn:Predator_Service")

##################################################
# file: Predator_Service_types.py
#
# schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#    /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/PredatorWS.wsdl
#
##################################################

import ZSI
import ZSI.TCcompound
from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED