Functional test
This is a test of the DSC protein secondary structure prediction (CNRS IBCP) service.
Test filesDownload the files for this test
Test runRun test now
Support reference#276-282
Show/hide recent test logs
view log 5 days agoPASSED
Test began: 2012-02-01 15:48:15 Test ended: 2012-02-01 15:48:22 Result : Test passedDownload this log...
view log 1 week agoPASSED
Test began: 2012-01-29 19:42:46 Test ended: 2012-01-29 19:43:05 Result : Test passedDownload this log...
view log 1 week agoPASSED
Test began: 2012-01-28 02:38:57 Test ended: 2012-01-28 02:39:11 Result : Test passedDownload this log...
view log 1 week agoPASSED
Test began: 2012-01-27 11:07:13 Test ended: 2012-01-27 11:07:28 Result : Test passedDownload this log...
view log 1 week agoPASSED
Test began: 2012-01-27 02:40:23 Test ended: 2012-01-27 02:40:41 Result : Test passedDownload this log...
view log 2 weeks agoPASSED
Test began: 2012-01-26 06:26:04 Test ended: 2012-01-26 06:26:16 Result : Test passedDownload this log...
view log 3 weeks agoPASSED
Test began: 2012-01-14 13:09:39 Test ended: 2012-01-14 13:09:48 Result : Test passedDownload this log...
view log 1 month agoPASSED
Test began: 2012-01-06 12:43:47 Test ended: 2012-01-06 12:43:52 Result : Test passedDownload this log...
view log 1 month agoPASSED
Test began: 2011-12-31 12:43:39 Test ended: 2011-12-31 12:43:44 Result : Test passedDownload this log...
view log 2 months agoPASSED
Test began: 2011-12-19 14:28:17 Test ended: 2011-12-19 14:43:27 Result : Test passedDownload this log...
This test consists of the following files:
__MACOSX/
._gbiowstest-dsc.py (binary file)
benchy_seq001.seq
>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009) MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG LAARRRCCRGYLLTRRYPWKGLCAGCRRWV
control-seq001.Dsc
DSC - Ross D. King First sequence predicted Predicted accuracy = 0.66 Input format = PIR/Fasta/ASCII: Output format = PIR/Fasta/ASCII: Filter level = 1: Singlets are removed: Regions of bad alignment are removed if they have 40 residues with less than 20 percent identity. /**********************************************************/ /**********************************************************/ /**********************************************************/ Unknow MKKITIYDLA ELSGVSASAV SAILNGNWKK RRISAKLAEK VTRIAEEQGY DSC_SECCCCCCCHHHH HCCCCCCCHH HHHHCCCCHH HHHHHHHHHH HHHHHHHHHH PROB_H 3233114678 6421224344 5556421356 7797999999 9999999657 PROB_E 1013443111 1010121333 3432000101 1111000000 0000000000 PROB_C 6864553321 3679765433 2122689653 2202111111 1111111453 Unknow AINRQASMLR SKKSHVIGMI IPKYDNRYFG SIAERFEEMA RERGLLPIIT DSC_SECHHHHHHHHHH CCCCCEEEEE CCCCCCCCCC HHHHHHHHHH HHCCCCCCCH PROB_H 9999999996 4444422110 2211224444 6999999999 9621114447 PROB_E 0000000001 0000146667 3100000000 0000000000 0000111111 PROB_C 1111111113 6666542333 5799886666 4111111111 1489885552 Unknow CTRRRPELEI EAVKAMLSWQ VDWVVATGAT NPDKISALCQ QAGVPTVNLD DSC_SECHCCCCCCHHH HHHHHHCCCE EEEEEECCCC CCCHHHHHHH CCCCCEEEEC PROB_H 5431134679 9999974311 1000011111 1125775565 3111110001 PROB_E 1010010110 0000011345 5799962100 0000113322 1011257774 PROB_C 4669966321 1111125454 4311137899 9985222223 6988743335 Unknow LPGSLSPSVI SDNYGGAKAL THKILANSAR RRGELAPLTF IGGRRATITP DSC_SECCCCCCCCEEE ECCCCCCHHH HHHHHHHHHH HHCCCCCCCC CCCCCCCCCC PROB_H 0111101101 1222114899 7799999997 6542214444 4212221111 PROB_E 1111112576 5211000100 1111000000 0001211111 1101133322 PROB_C 9888897433 4677996111 2200111113 4567685555 5797756677 Unknow ASVYAASTMR IASWGLACRR RIFWLPAIRK ATLRTACRSG LAARRRCCRG DSC_SECCCCCHHHHHH HHHHHHHHHH HHHHHHHHHH HHHHHHHHHC CCHHHHHHHC PROB_H 2311455776 7786555556 7767679979 7777999954 4355899754 PROB_E 3344221111 1110000001 1111100000 0111000000 1112100000 PROB_C 5455434223 2214555553 2232331131 3222111156 5643111356 Unknow YLLTRRYPWK GLCAGCRRWV DSC_SECCCCCCCCCCC CCCCCCCCCC PROB_H 2333221123 2223234323 PROB_E 2331110001 1111010111 PROB_C 6446779986 7776866676 /**********************************************************/ /**********************************************************/ /**********************************************************/ NO. RES DSC_SEC PROB_H PROB_E PROB_C 1 m C 0.255 0.051 0.694 2 k C 0.185 0.021 0.794 3 k C 0.319 0.128 0.553 4 i C 0.302 0.299 0.399 5 t C 0.100 0.400 0.500 6 i C 0.100 0.400 0.500 7 y H 0.416 0.348 0.236 8 d H 0.621 0.113 0.266 9 l H 0.745 0.119 0.136 10 a H 0.790 0.067 0.143 11 e H 0.626 0.096 0.278 12 l C 0.366 0.042 0.592 13 s C 0.189 0.138 0.673 14 g C 0.070 0.040 0.890 15 v C 0.189 0.134 0.677 16 s C 0.239 0.180 0.581 17 a C 0.393 0.150 0.457 18 s C 0.302 0.299 0.399 19 a H 0.443 0.344 0.213 20 v H 0.416 0.348 0.236 21 s H 0.510 0.314 0.176 22 a H 0.524 0.381 0.095 23 i H 0.510 0.314 0.176 24 l H 0.603 0.167 0.230 25 n C 0.366 0.042 0.592 26 g C 0.185 0.021 0.794 27 n C 0.087 0.020 0.893 28 w C 0.255 0.051 0.694 29 k H 0.517 0.046 0.437 30 k H 0.626 0.096 0.278 31 r H 0.745 0.119 0.136 32 r H 0.686 0.149 0.165 33 i H 0.851 0.085 0.064 34 s H 0.686 0.149 0.165 35 a H 0.893 0.032 0.075 36 k H 0.945 0.014 0.041 37 l H 0.877 0.004 0.119 38 a H 0.877 0.004 0.119 39 e H 0.877 0.004 0.119 40 k H 0.877 0.004 0.119 41 v H 0.905 0.015 0.080 42 t H 0.945 0.014 0.041 43 r H 0.893 0.032 0.075 44 i H 0.893 0.032 0.075 45 a H 0.893 0.032 0.075 46 e H 0.905 0.015 0.080 47 e H 0.877 0.004 0.119 48 q H 0.589 0.036 0.375 49 g H 0.517 0.046 0.437 50 y H 0.723 0.020 0.257 51 a H 0.877 0.004 0.119 52 i H 0.905 0.015 0.080 53 n H 0.877 0.004 0.119 54 r H 0.877 0.004 0.119 55 q H 0.905 0.015 0.080 56 a H 0.945 0.014 0.041 57 s H 0.945 0.014 0.041 58 m H 0.893 0.032 0.075 59 l H 0.893 0.032 0.075 60 r H 0.626 0.096 0.278 61 s C 0.366 0.042 0.592 62 k C 0.366 0.042 0.592 63 k C 0.366 0.042 0.592 64 s C 0.366 0.042 0.592 65 h C 0.393 0.150 0.457 66 v E 0.198 0.418 0.384 67 i E 0.163 0.589 0.248 68 g E 0.144 0.648 0.208 69 m E 0.144 0.648 0.208 70 i E 0.026 0.696 0.278 71 i C 0.181 0.348 0.471 72 p C 0.189 0.134 0.677 73 k C 0.070 0.040 0.890 74 y C 0.091 0.027 0.882 75 d C 0.185 0.021 0.794 76 n C 0.185 0.021 0.794 77 r C 0.366 0.042 0.592 78 y C 0.366 0.042 0.592 79 f C 0.366 0.042 0.592 80 g C 0.366 0.042 0.592 81 s H 0.589 0.036 0.375 82 i H 0.905 0.015 0.080 83 a H 0.905 0.015 0.080 84 e H 0.877 0.004 0.119 85 r H 0.877 0.004 0.119 86 f H 0.905 0.015 0.080 87 e H 0.905 0.015 0.080 88 e H 0.877 0.004 0.119 89 m H 0.877 0.004 0.119 90 a H 0.877 0.004 0.119 91 r H 0.877 0.004 0.119 92 e H 0.589 0.036 0.375 93 r C 0.185 0.021 0.794 94 g C 0.070 0.040 0.890 95 l C 0.110 0.069 0.821 96 l C 0.110 0.069 0.821 97 p C 0.393 0.150 0.457 98 i C 0.400 0.100 0.500 99 i C 0.400 0.100 0.500 100 t H 0.662 0.080 0.259 101 c H 0.484 0.118 0.398 102 t C 0.366 0.042 0.592 103 r C 0.255 0.051 0.694 104 r C 0.087 0.020 0.893 105 r C 0.087 0.020 0.893 106 p C 0.255 0.051 0.694 107 e C 0.366 0.042 0.592 108 l H 0.626 0.096 0.278 109 e H 0.745 0.119 0.136 110 i H 0.910 0.036 0.054 111 e H 0.893 0.032 0.075 112 a H 0.893 0.032 0.075 113 v H 0.945 0.014 0.041 114 k H 0.945 0.014 0.041 115 a H 0.945 0.014 0.041 116 m H 0.662 0.080 0.259 117 l C 0.400 0.100 0.500 118 s C 0.302 0.299 0.399 119 w C 0.130 0.429 0.441 120 q E 0.056 0.476 0.468 121 v E 0.070 0.466 0.464 122 d E 0.026 0.696 0.278 123 w E 0.027 0.888 0.085 124 v E 0.027 0.888 0.085 125 v E 0.046 0.867 0.087 126 a E 0.144 0.648 0.208 127 t C 0.145 0.192 0.665 128 g C 0.088 0.085 0.827 129 a C 0.070 0.040 0.890 130 t C 0.091 0.027 0.882 131 n C 0.091 0.027 0.882 132 p C 0.087 0.020 0.893 133 d C 0.185 0.021 0.794 134 k H 0.517 0.046 0.437 135 i H 0.662 0.080 0.259 136 s H 0.686 0.149 0.165 137 a H 0.542 0.301 0.157 138 l H 0.542 0.301 0.157 139 c H 0.603 0.167 0.230 140 q H 0.519 0.156 0.325 141 q C 0.255 0.051 0.694 142 a C 0.070 0.040 0.890 143 g C 0.110 0.069 0.821 144 v C 0.062 0.088 0.850 145 p C 0.086 0.160 0.754 146 t E 0.056 0.476 0.468 147 v E 0.026 0.661 0.313 148 n E 0.026 0.661 0.313 149 l E 0.026 0.661 0.313 150 d C 0.067 0.365 0.568 151 l C 0.032 0.100 0.868 152 p C 0.062 0.121 0.817 153 g C 0.062 0.088 0.850 154 s C 0.062 0.121 0.817 155 l C 0.062 0.121 0.817 156 s C 0.032 0.100 0.868 157 p C 0.086 0.160 0.754 158 s E 0.056 0.476 0.468 159 v E 0.026 0.696 0.278 160 i E 0.094 0.650 0.256 161 s E 0.092 0.511 0.397 162 d C 0.239 0.180 0.581 163 n C 0.207 0.122 0.671 164 y C 0.207 0.122 0.671 165 g C 0.091 0.027 0.882 166 g C 0.087 0.020 0.893 167 a C 0.366 0.042 0.592 168 k H 0.751 0.065 0.184 169 a H 0.893 0.032 0.075 170 l H 0.893 0.032 0.075 171 t H 0.745 0.119 0.136 172 h H 0.686 0.149 0.165 173 k H 0.851 0.085 0.064 174 i H 0.851 0.085 0.064 175 l H 0.910 0.036 0.054 176 a H 0.945 0.014 0.041 177 n H 0.877 0.004 0.119 178 s H 0.877 0.004 0.119 179 a H 0.877 0.004 0.119 180 r H 0.723 0.020 0.257 181 r H 0.589 0.036 0.375 182 r H 0.517 0.046 0.437 183 g C 0.366 0.042 0.592 184 e C 0.210 0.090 0.700 185 l C 0.239 0.180 0.581 186 a C 0.110 0.069 0.821 187 p C 0.393 0.150 0.457 188 l C 0.400 0.100 0.500 189 t C 0.400 0.100 0.500 190 f C 0.400 0.100 0.500 191 i C 0.393 0.150 0.457 192 g C 0.207 0.122 0.671 193 g C 0.087 0.020 0.893 194 r C 0.207 0.122 0.671 195 r C 0.189 0.138 0.673 196 a C 0.194 0.267 0.539 197 t C 0.119 0.260 0.621 198 i C 0.119 0.260 0.621 199 t C 0.059 0.209 0.732 200 p C 0.101 0.175 0.725 201 a C 0.194 0.267 0.539 202 s C 0.275 0.330 0.395 203 v C 0.100 0.400 0.500 204 y C 0.100 0.400 0.500 205 a H 0.422 0.216 0.362 206 a H 0.519 0.156 0.325 207 s H 0.484 0.118 0.398 208 t H 0.662 0.080 0.259 209 m H 0.745 0.119 0.136 210 r H 0.621 0.113 0.266 211 i H 0.686 0.149 0.165 212 a H 0.745 0.119 0.136 213 s H 0.751 0.065 0.184 214 w H 0.589 0.036 0.375 215 g H 0.517 0.046 0.437 216 l H 0.517 0.046 0.437 217 a H 0.517 0.046 0.437 218 c H 0.517 0.046 0.437 219 r H 0.517 0.046 0.437 220 r H 0.626 0.096 0.278 221 r H 0.745 0.119 0.136 222 i H 0.686 0.149 0.165 223 f H 0.621 0.113 0.266 224 w H 0.662 0.080 0.259 225 l H 0.626 0.096 0.278 226 p H 0.723 0.020 0.257 227 a H 0.877 0.004 0.119 228 i H 0.877 0.004 0.119 229 r H 0.723 0.020 0.257 230 k H 0.877 0.004 0.119 231 a H 0.723 0.020 0.257 232 t H 0.662 0.080 0.259 233 l H 0.662 0.080 0.259 234 r H 0.745 0.119 0.136 235 t H 0.945 0.014 0.041 236 a H 0.905 0.015 0.080 237 c H 0.877 0.004 0.119 238 r H 0.877 0.004 0.119 239 s H 0.517 0.046 0.437 240 g C 0.366 0.042 0.592 241 l C 0.400 0.100 0.500 242 a C 0.319 0.128 0.553 243 a H 0.484 0.118 0.398 244 r H 0.519 0.156 0.325 245 r H 0.751 0.065 0.184 246 r H 0.905 0.015 0.080 247 c H 0.877 0.004 0.119 248 c H 0.723 0.020 0.257 249 r H 0.517 0.046 0.437 250 g C 0.366 0.042 0.592 251 y C 0.249 0.234 0.517 252 l C 0.302 0.299 0.399 253 l C 0.302 0.299 0.399 254 t C 0.319 0.128 0.553 255 r C 0.210 0.090 0.700 256 r C 0.207 0.122 0.671 257 y C 0.091 0.027 0.882 258 p C 0.087 0.020 0.893 259 w C 0.185 0.021 0.794 260 k C 0.255 0.051 0.694 261 g C 0.189 0.138 0.673 262 l C 0.189 0.138 0.673 263 c C 0.210 0.090 0.700 264 a C 0.255 0.051 0.694 265 g C 0.185 0.021 0.794 266 c C 0.255 0.051 0.694 267 r C 0.366 0.042 0.592 268 r C 0.255 0.051 0.694 269 w C 0.210 0.090 0.700 270 v C 0.255 0.051 0.694
Dsc_Service_client.py
##################################################
# file: Dsc_Service_client.py
#
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
# /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/DscWS.wsdl
#
##################################################
import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI
# Locator
class Dsc_ServiceLocator:
DscPort_address = "http://gbio.ibcp.fr:8090/Dsc_Service"
def getDscPortAddress(self):
return Dsc_ServiceLocator.DscPort_address
def getDscPort(self, url=None, **kw):
return DscBindingSOAP(url or Dsc_ServiceLocator.DscPort_address, **kw)
# Methods
class DscBindingSOAP:
def __init__(self, url, **kw):
kw.setdefault("readerclass", None)
kw.setdefault("writerclass", None)
# no resource properties
self.binding = client.Binding(url=url, **kw)
# no ws-addressing
# op: submitDsc
def submitDsc(self, request, **kw):
if isinstance(request, submitDscRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:DscWS.wsdl#submitDsc", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=submitDscResponse.typecode.ofwhat, pyclass=submitDscResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: checkStatusDsc
def checkStatusDsc(self, request, **kw):
if isinstance(request, checkStatusDscRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:DscWS.wsdl#checkStatusDsc", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=checkStatusDscResponse.typecode.ofwhat, pyclass=checkStatusDscResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: getResultsDsc
def getResultsDsc(self, request, **kw):
if isinstance(request, getResultsDscRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:DscWS.wsdl#getResultsDsc", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=getResultsDscResponse.typecode.ofwhat, pyclass=getResultsDscResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: cancelDsc
def cancelDsc(self, request, **kw):
if isinstance(request, cancelDscRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:DscWS.wsdl#cancelDsc", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=cancelDscResponse.typecode.ofwhat, pyclass=cancelDscResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
class submitDscRequest:
def __init__(self, **kw):
"""Keyword parameters:
Sequences -- part Sequences
"""
self._Sequences = kw.get("Sequences")
submitDscRequest.typecode = Struct(pname=("urn:Dsc_Service","submitDsc"), ofwhat=[ZSI.TC.String(pname="Sequences", aname="_Sequences", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitDscRequest, encoded="urn:Dsc_Service")
class submitDscResponse:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
submitDscResponse.typecode = Struct(pname=("urn:Dsc_Service","submitDscResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitDscResponse, encoded="urn:Dsc_Service")
class checkStatusDscRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
checkStatusDscRequest.typecode = Struct(pname=("urn:Dsc_Service","checkStatusDsc"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusDscRequest, encoded="urn:Dsc_Service")
class checkStatusDscResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
checkStatusDscResponse.typecode = Struct(pname=("urn:Dsc_Service","checkStatusDscResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusDscResponse, encoded="urn:Dsc_Service")
class getResultsDscRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
getResultsDscRequest.typecode = Struct(pname=("urn:Dsc_Service","getResultsDsc"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsDscRequest, encoded="urn:Dsc_Service")
class getResultsDscResponse:
def __init__(self, **kw):
"""Keyword parameters:
SecStructure -- part SecStructure
Logout -- part Logout
"""
self._SecStructure = kw.get("SecStructure")
self._Logout = kw.get("Logout")
getResultsDscResponse.typecode = Struct(pname=("urn:Dsc_Service","getResultsDscResponse"), ofwhat=[ZSI.TC.String(pname="SecStructure", aname="_SecStructure", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True), ZSI.TC.String(pname="Logout", aname="_Logout", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsDscResponse, encoded="urn:Dsc_Service")
class cancelDscRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
cancelDscRequest.typecode = Struct(pname=("urn:Dsc_Service","cancelDsc"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelDscRequest, encoded="urn:Dsc_Service")
class cancelDscResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
cancelDscResponse.typecode = Struct(pname=("urn:Dsc_Service","cancelDscResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelDscResponse, encoded="urn:Dsc_Service")
Dsc_Service_client.pyc (binary file)
Dsc_Service_types.py
################################################## # file: Dsc_Service_types.py # # schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule" # /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/DscWS.wsdl # ################################################## import ZSI import ZSI.TCcompound from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED
gbiowstest-dsc.py
#!/usr/bin/env python
# ================================================================================
#
# COPYRIGHT NOTICE
#
# Centre National de la Recherche Scientifique
# CNRS
#
# Institut de Biologie et Chimie des Proteines
# IBCP CNRS UMR 5086
# 7 passage du Vercors
# 69007 Lyon, FRANCE
#
# This software/database is covered by copyright of CNRS IBCP
# All rights reserved. Reproduction and usage of this software/database are
# strictly restricted, and need a prior written permission from CNRS IBCP
# (see "Contact" below).
#
# CNRS IBCP do not and cannot warrant the performance or results that
# may be obtained by using this software or data. CNRS IBCP disclaim all
# warranties, express or implied, including warranties of performance,
# merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date: 18/11/2008
#
# $Revision: 1.0 $
#
# File Description:
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date Name Description of modification
# ------- ---------- -----------------------------------------------------
#
# ================================================================================
import sys
import time
from Dsc_Service_client import *
fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.Dsc'
ret = 0
# get a port proxy instance
loc = Dsc_ServiceLocator()
port = loc.getDscPort()
###
# submit a new request
# create
req = submitDscRequest()
fp_input = open (fn_input, 'r')
req._Sequences = fp_input.read()
# call the remote method
resp = port.submitDsc(req)
jobid = resp._JobId
#print jobid
if not jobid:
ret = 1
###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusDscRequest()
req._JobId = jobid
while status not in ('done','aborted'):
time.sleep(2)
resp = port.checkStatusDsc(req)
status = resp._Status
#print status
if status != 'done':
ret = 1
###
# get results
req = getResultsDscRequest()
req._JobId = jobid
resp = port.getResultsDsc(req)
# write result
#open(fn_control,'w').write(resp._SecStructure)
#compare result with ref
resultcontrol = open(fn_control, 'r').read()
if resp._SecStructure != resultcontrol:
ret = 1
#print "wooohh"
#print ret
sys.exit (ret)
»
- Login to post comments