Functional test

This is a test of the PcProf predict physico-chemical profiles of proteins (CNRS IBCP) service.
Test filesDownload the files for this test
Test runRun test now
Support reference#275-283
Show/hide recent test logs
view log 6 days agoPASSED

Test began: 2012-02-01 01:21:25 Test ended: 2012-02-01 01:21:33 Result : Test passedDownload this log...
view log 1 week agoPASSED

Test began: 2012-01-30 11:26:06 Test ended: 2012-01-30 11:26:18 Result : Test passedDownload this log...
view log 2 weeks agoPASSED

Test began: 2012-01-21 01:07:18 Test ended: 2012-01-21 01:07:33 Result : Test passedDownload this log...
view log 3 weeks agoPASSED

Test began: 2012-01-17 00:49:08 Test ended: 2012-01-17 00:49:14 Result : Test passedDownload this log...
view log 3 weeks agoPASSED

Test began: 2012-01-15 02:54:09 Test ended: 2012-01-15 02:54:14 Result : Test passedDownload this log...
view log 4 weeks agoPASSED

Test began: 2012-01-12 22:14:00 Test ended: 2012-01-12 22:14:20 Result : Test passedDownload this log...
view log 4 weeks agoPASSED

Test began: 2012-01-11 20:50:24 Test ended: 2012-01-11 20:50:29 Result : Test passedDownload this log...
view log 4 weeks agoPASSED

Test began: 2012-01-07 17:44:26 Test ended: 2012-01-07 17:44:33 Result : Test passedDownload this log...
view log 1 month agoPASSED

Test began: 2012-01-06 07:54:58 Test ended: 2012-01-06 07:55:03 Result : Test passedDownload this log...
view log 1 month agoPASSED

Test began: 2011-12-25 10:17:15 Test ended: 2011-12-25 10:17:26 Result : Test passedDownload this log...
This test consists of the following files:
__MACOSX/
._gbiowstest-pcprof.py (binary file)
benchy_seq001.seq
>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009) MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG LAARRRCCRGYLLTRRYPWKGLCAGCRRWV
control-seq001.PcProf
MPSA code : physchem primname Unknown ; primlen 270 >Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009) compwin 7 ; methnb 7 ; meths 1 2 3 4 5 6 7 Hydrophilicity (Hoop & Woods, 1981) Hydropathy (Kyte & Doolittle, 1982) Flexibility (Karplus & Schulz, 1985) Antigenicity (Parker et al., 1986) Accessibility (Janin, 1979) Membrane buried-helix (Argos, 1986) Antigenicity (Welling, 1985) M 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 K 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 K 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 I 3.429e-01 -1.029e+00 9.926e-01 0.000e+00 6.243e+00 3.471e-01 5.714e-03 T 9.571e-01 -1.800e+00 9.660e-01 0.000e+00 6.557e+00 1.600e-01 1.536e-01 I 2.714e-01 -7.000e-01 9.419e-01 0.000e+00 3.671e+00 3.571e-01 2.313e-01 Y -2.286e-01 1.143e-01 9.331e-01 0.000e+00 8.143e-01 5.386e-01 2.183e-01 D 4.571e-01 -1.029e+00 9.340e-01 0.000e+00 1.229e+00 3.686e-01 6.253e-01 L 2.571e-01 -3.857e-01 9.414e-01 0.000e+00 1.086e+00 4.243e-01 7.389e-01 A 5.571e-01 -1.143e+00 9.526e-01 0.000e+00 1.214e+00 3.571e-01 1.152e+00 E 8.857e-01 -1.014e+00 9.664e-01 0.000e+00 1.014e+00 3.943e-01 1.124e+00 L 2.429e-01 8.571e-02 9.831e-01 0.000e+00 6.714e-01 5.743e-01 1.029e+00 S 5.429e-01 -5.714e-01 9.949e-01 4.479e-01 7.857e-01 5.029e-01 9.186e-01 G 5.429e-01 -5.714e-01 1.001e+00 4.479e-01 7.857e-01 5.029e-01 9.186e-01 V 1.571e-01 -1.857e-01 9.932e-01 0.000e+00 5.000e-01 6.057e-01 9.250e-01 S 3.429e-01 -4.714e-01 9.803e-01 4.549e+01 5.286e-01 5.900e-01 8.343e-01 A 8.571e-02 2.429e-01 9.704e-01 0.000e+00 4.000e-01 6.471e-01 8.361e-01 S 1.286e-01 1.857e-01 9.536e-01 3.151e+00 4.857e-01 6.300e-01 8.587e-01 A 2.714e-01 -1.571e-01 9.457e-01 2.928e+01 5.286e-01 6.286e-01 8.770e-01 V -2.857e-02 6.000e-01 9.354e-01 0.000e+00 4.000e-01 6.957e-01 4.636e-01 S -2.143e-01 8.857e-01 9.269e-01 0.000e+00 3.714e-01 7.114e-01 5.543e-01 A -2.286e-01 5.000e-01 9.311e-01 0.000e+00 5.286e-01 6.200e-01 4.480e-01 I -1.571e-01 1.857e-01 9.460e-01 0.000e+00 5.286e-01 5.814e-01 4.053e-01 L 8.571e-02 -9.143e-01 9.739e-01 0.000e+00 8.143e-01 4.329e-01 2.971e-01 N -4.429e-01 -9.286e-01 9.975e-01 0.000e+00 7.286e-01 4.371e-01 2.846e-01 G 5.714e-02 -1.743e+00 1.021e+00 0.000e+00 3.586e+00 2.557e-01 2.976e-01 N 7.429e-01 -2.943e+00 1.028e+00 2.257e+01 6.486e+00 6.286e-02 7.441e-01 W 1.429e+00 -4.129e+00 1.030e+00 6.578e+01 7.714e+00 -1.257e-01 6.453e-01 K 1.829e+00 -4.271e+00 1.040e+00 7.177e+01 8.671e+00 -1.514e-01 7.636e-01 K 1.571e+00 -3.571e+00 1.040e+00 4.738e+01 8.629e+00 -1.014e-01 3.727e-01 R 1.586e+00 -3.186e+00 1.033e+00 4.011e+01 8.471e+00 -1.000e-02 4.790e-01 R 2.000e+00 -2.800e+00 1.024e+00 3.797e+01 8.471e+00 4.143e-02 5.117e-01 I 2.000e+00 -2.800e+00 1.011e+00 3.797e+01 8.471e+00 4.143e-02 5.117e-01 S 1.314e+00 -1.700e+00 9.994e-01 0.000e+00 5.586e+00 2.386e-01 5.894e-01 A 8.143e-01 -8.000e-01 1.000e+00 0.000e+00 4.386e+00 4.114e-01 5.976e-01 K 8.143e-01 -6.571e-01 1.001e+00 0.000e+00 3.557e+00 4.257e-01 5.791e-01 L 1.500e+00 -1.857e+00 1.001e+00 2.297e+01 6.457e+00 2.329e-01 1.026e+00 A 1.243e+00 -1.143e+00 1.005e+00 0.000e+00 6.329e+00 2.900e-01 1.028e+00 E 1.257e+00 -1.500e+00 1.014e+00 0.000e+00 6.443e+00 2.500e-01 1.005e+00 K 1.257e+00 -1.586e+00 1.023e+00 0.000e+00 4.786e+00 2.586e-01 9.836e-01 V 1.257e+00 -1.486e+00 1.018e+00 0.000e+00 4.771e+00 2.543e-01 4.593e-01 T 1.257e+00 -1.486e+00 1.010e+00 0.000e+00 4.771e+00 2.543e-01 4.593e-01 R 1.257e+00 -1.486e+00 9.947e-01 0.000e+00 4.771e+00 2.543e-01 4.593e-01 I 1.257e+00 -1.429e+00 9.837e-01 0.000e+00 2.286e+00 2.771e-01 4.197e-01 A 1.500e+00 -2.529e+00 1.002e+00 4.279e+01 2.700e+00 1.286e-01 4.200e-01 E 1.557e+00 -2.486e+00 1.028e+00 4.504e+01 2.586e+00 1.300e-01 4.001e-01 E 8.000e-01 -2.029e+00 1.049e+00 1.757e+01 1.586e+00 2.271e-01 3.937e-01 Q 9.857e-01 -2.414e+00 1.052e+00 6.306e+01 1.629e+00 2.157e-01 8.273e-01 G 8.000e-01 -2.029e+00 1.022e+00 1.757e+01 1.586e+00 2.271e-01 3.937e-01 Y 4.000e-01 -2.029e+00 9.835e-01 1.396e+01 1.457e+00 2.386e-01 2.939e-01 A 4.000e-01 -2.171e+00 9.583e-01 0.000e+00 2.286e+00 2.243e-01 3.123e-01 I 4.000e-01 -2.171e+00 9.543e-01 0.000e+00 2.286e+00 2.243e-01 3.123e-01 N 3.286e-01 -1.857e+00 9.766e-01 1.611e+00 2.286e+00 2.629e-01 3.550e-01 R 7.000e-01 -1.786e+00 9.959e-01 1.937e+01 2.171e+00 2.829e-01 3.494e-01 Q 5.857e-01 -1.771e+00 9.976e-01 0.000e+00 2.157e+00 2.914e-01 2.780e-01 A 5.857e-01 -1.871e+00 9.865e-01 5.889e+00 2.171e+00 2.957e-01 8.023e-01 S 9.857e-01 -2.014e+00 9.653e-01 1.188e+01 3.129e+00 2.700e-01 9.206e-01 M 6.000e-01 -1.486e+00 9.647e-01 0.000e+00 2.014e+00 3.871e-01 9.086e-01 L 1.000e+00 -1.543e+00 9.895e-01 3.323e+00 4.500e+00 3.529e-01 9.396e-01 R 1.500e+00 -2.357e+00 1.027e+00 3.455e+01 7.357e+00 1.714e-01 9.526e-01 S 1.500e+00 -2.357e+00 1.066e+00 3.455e+01 7.357e+00 1.714e-01 9.526e-01 K 1.614e+00 -3.086e+00 1.076e+00 5.508e+01 7.457e+00 6.571e-02 1.052e+00 K 1.657e+00 -3.029e+00 1.061e+00 5.135e+01 7.443e+00 5.143e-02 9.431e-01 S 9.714e-01 -1.743e+00 1.025e+00 0.000e+00 6.200e+00 2.357e-01 5.177e-01 H 9.286e-01 -1.686e+00 9.798e-01 0.000e+00 6.114e+00 2.529e-01 4.951e-01 V 3.143e-01 -8.571e-01 9.426e-01 0.000e+00 3.243e+00 4.429e-01 4.107e-01 I -3.714e-01 3.429e-01 9.140e-01 0.000e+00 3.429e-01 6.357e-01 -3.586e-02 G -6.714e-01 1.100e+00 8.980e-01 0.000e+00 2.143e-01 7.029e-01 -4.493e-01 M -6.000e-01 1.329e+00 8.999e-01 0.000e+00 3.000e-01 6.829e-01 -5.014e-01 I 4.286e-02 1.714e-01 9.213e-01 0.000e+00 3.200e+00 5.000e-01 -4.701e-01 I -2.857e-02 -6.571e-01 9.507e-01 0.000e+00 3.443e+00 4.129e-01 -5.114e-02 P 4.000e-01 -1.100e+00 9.924e-01 0.000e+00 3.743e+00 2.729e-01 6.800e-02 K 6.143e-01 -1.871e+00 1.026e+00 0.000e+00 4.000e+00 1.171e-01 1.300e-02 Y 1.300e+00 -3.157e+00 1.043e+00 5.123e+01 5.243e+00 -6.714e-02 4.384e-01 D 1.229e+00 -3.986e+00 1.052e+00 1.000e+02 5.486e+00 -1.543e-01 8.574e-01 N 8.714e-01 -3.357e+00 1.037e+00 7.006e+01 5.300e+00 -7.143e-03 8.449e-01 R 4.429e-01 -2.857e+00 1.016e+00 3.712e+01 2.443e+00 1.357e-01 7.891e-01 Y 8.143e-01 -2.786e+00 9.997e-01 3.156e+01 2.329e+00 1.557e-01 7.836e-01 F 1.286e-01 -1.643e+00 9.828e-01 0.000e+00 1.986e+00 3.457e-01 2.736e-01 G 2.857e-02 -8.857e-01 9.791e-01 0.000e+00 1.743e+00 4.929e-01 4.000e-01 S 2.857e-02 -7.429e-01 9.798e-01 0.000e+00 9.143e-01 5.071e-01 3.816e-01 I 7.857e-01 -1.200e+00 9.779e-01 0.000e+00 1.914e+00 4.100e-01 3.880e-01 A 7.857e-01 -1.200e+00 9.808e-01 0.000e+00 1.914e+00 4.100e-01 3.880e-01 E 1.214e+00 -1.643e+00 9.871e-01 0.000e+00 2.286e+00 2.900e-01 4.041e-01 R 1.600e+00 -2.029e+00 9.939e-01 0.000e+00 2.571e+00 1.871e-01 3.977e-01 F 1.671e+00 -2.400e+00 9.915e-01 2.086e+01 2.600e+00 1.843e-01 7.599e-01 E 1.671e+00 -2.400e+00 9.878e-01 2.086e+01 2.600e+00 1.843e-01 7.599e-01 E 1.671e+00 -2.543e+00 9.779e-01 2.471e+01 3.429e+00 1.700e-01 7.783e-01 M 1.671e+00 -2.400e+00 9.716e-01 2.086e+01 2.600e+00 1.843e-01 7.599e-01 A 2.457e+00 -3.443e+00 9.868e-01 6.351e+01 3.814e+00 -1.857e-02 7.883e-01 R 2.029e+00 -3.000e+00 1.007e+00 5.405e+01 3.443e+00 1.014e-01 7.721e-01 E 1.343e+00 -1.957e+00 1.023e+00 0.000e+00 3.043e+00 2.757e-01 8.894e-01 R 1.271e+00 -1.686e+00 1.028e+00 0.000e+00 3.029e+00 2.829e-01 1.052e+00 G 1.343e+00 -2.171e+00 1.015e+00 4.178e+00 3.200e+00 1.657e-01 1.028e+00 L 6.571e-01 -8.857e-01 9.862e-01 0.000e+00 1.957e+00 3.500e-01 6.021e-01 L -2.857e-02 2.571e-01 9.576e-01 0.000e+00 1.543e+00 5.200e-01 1.951e-01 P -5.143e-01 8.000e-01 9.356e-01 0.000e+00 4.571e-01 6.529e-01 1.804e-01 I -6.571e-01 1.214e+00 9.219e-01 0.000e+00 4.000e-01 6.786e-01 1.896e-01 I -4.571e-01 5.714e-01 9.276e-01 0.000e+00 5.429e-01 6.229e-01 7.600e-02 T 2.286e-01 -6.143e-01 9.467e-01 0.000e+00 1.771e+00 4.343e-01 -2.286e-02 C 6.571e-01 -1.029e+00 9.741e-01 0.000e+00 2.800e+00 3.786e-01 -7.000e-03 T 1.343e+00 -2.314e+00 1.005e+00 3.601e+00 4.043e+00 1.943e-01 4.184e-01 R 1.600e+00 -3.186e+00 1.025e+00 4.910e+01 4.257e+00 6.571e-02 8.280e-01 R 2.086e+00 -3.586e+00 1.037e+00 6.081e+01 4.514e+00 -5.286e-02 8.243e-01 R 1.971e+00 -3.400e+00 1.037e+00 6.792e+01 4.543e+00 -2.429e-02 9.486e-01 P 2.457e+00 -3.800e+00 1.026e+00 7.562e+01 4.800e+00 -1.429e-01 9.449e-01 E 1.771e+00 -2.514e+00 1.012e+00 1.915e+01 3.557e+00 4.143e-02 5.194e-01 L 1.771e+00 -2.371e+00 9.913e-01 1.530e+01 2.729e+00 5.571e-02 5.010e-01 E 1.271e+00 -1.471e+00 9.736e-01 0.000e+00 1.529e+00 2.286e-01 5.091e-01 I 1.057e+00 -6.429e-01 9.622e-01 0.000e+00 1.314e+00 3.471e-01 5.149e-01 E 1.057e+00 -7.000e-01 9.575e-01 0.000e+00 3.800e+00 3.243e-01 5.544e-01 A 1.243e+00 -9.857e-01 9.601e-01 0.000e+00 3.829e+00 3.086e-01 4.637e-01 V 6.286e-01 -2.143e-01 9.551e-01 0.000e+00 3.443e+00 4.757e-01 4.189e-01 K 6.286e-01 -3.143e-01 9.526e-01 0.000e+00 3.457e+00 4.800e-01 9.431e-01 A 2.429e-01 7.143e-02 9.382e-01 0.000e+00 3.171e+00 5.829e-01 9.496e-01 M -1.714e-01 -3.143e-01 9.218e-01 0.000e+00 3.171e+00 5.314e-01 9.169e-01 L 7.143e-02 -1.414e+00 9.193e-01 0.000e+00 3.586e+00 3.829e-01 9.171e-01 S -5.714e-01 -2.571e-01 9.160e-01 0.000e+00 6.857e-01 5.657e-01 8.859e-01 W -7.143e-02 -1.014e+00 9.216e-01 0.000e+00 9.857e-01 3.871e-01 9.623e-01 Q -3.714e-01 -1.414e+00 9.281e-01 0.000e+00 1.000e+00 3.271e-01 1.001e+00 V -3.286e-01 -1.357e+00 9.312e-01 0.000e+00 9.857e-01 3.129e-01 8.920e-01 D -5.857e-01 -6.429e-01 9.287e-01 0.000e+00 8.571e-01 3.700e-01 8.939e-01 W -1.714e-01 -2.571e-01 9.265e-01 0.000e+00 8.571e-01 4.214e-01 9.266e-01 V -2.571e-01 1.429e-01 9.332e-01 0.000e+00 6.000e-01 5.286e-01 9.217e-01 V -4.286e-02 -5.143e-01 9.462e-01 0.000e+00 6.429e-01 4.886e-01 8.973e-01 A -5.429e-01 2.429e-01 9.715e-01 0.000e+00 3.429e-01 6.671e-01 8.209e-01 T -1.143e-01 2.714e-01 1.002e+00 0.000e+00 4.571e-01 6.786e-01 8.307e-01 G 1.286e-01 -8.286e-01 1.029e+00 3.603e+01 7.429e-01 5.300e-01 7.226e-01 A 3.429e-01 -1.657e+00 1.049e+00 6.216e+01 9.571e-01 4.114e-01 7.169e-01 T 8.429e-01 -2.414e+00 1.060e+00 9.775e+01 1.257e+00 2.329e-01 7.933e-01 N 1.329e+00 -2.871e+00 1.066e+00 1.000e+02 4.000e+00 9.143e-02 8.291e-01 P 1.071e+00 -2.171e+00 1.061e+00 3.829e+01 3.957e+00 1.414e-01 4.383e-01 D 1.186e+00 -2.543e+00 1.047e+00 5.811e+01 4.043e+00 8.571e-02 4.181e-01 K 1.171e+00 -2.186e+00 1.028e+00 4.414e+01 3.929e+00 1.257e-01 4.410e-01 I 8.857e-01 -1.143e+00 9.973e-01 0.000e+00 3.657e+00 2.886e-01 6.581e-01 S 7.429e-01 -5.571e-01 9.658e-01 0.000e+00 3.429e+00 3.929e-01 6.486e-01 A 3.429e-01 -5.571e-01 9.491e-01 0.000e+00 3.500e+00 4.243e-01 5.541e-01 L -5.714e-02 -5.000e-01 9.430e-01 0.000e+00 1.014e+00 4.586e-01 5.231e-01 C 1.286e-01 -8.857e-01 9.544e-01 0.000e+00 1.057e+00 4.471e-01 9.567e-01 Q 8.571e-02 -8.286e-01 9.764e-01 0.000e+00 9.714e-01 4.643e-01 9.341e-01 Q -5.714e-02 -4.857e-01 9.890e-01 0.000e+00 9.286e-01 4.657e-01 9.159e-01 A 2.000e-01 -1.257e+00 1.000e+00 1.802e+01 1.129e+00 3.329e-01 8.011e-01 G 2.857e-01 -1.714e+00 1.004e+00 3.513e+01 1.300e+00 3.057e-01 8.119e-01 V 4.286e-02 -6.143e-01 1.009e+00 0.000e+00 8.857e-01 4.543e-01 8.116e-01 P 4.286e-02 -6.143e-01 1.014e+00 0.000e+00 7.571e-01 4.543e-01 7.031e-01 T -1.429e-01 -3.286e-01 1.007e+00 0.000e+00 7.286e-01 4.700e-01 7.939e-01 V 2.857e-01 -7.714e-01 9.931e-01 0.000e+00 1.029e+00 3.300e-01 9.130e-01 N 2.429e-01 -8.286e-01 9.741e-01 0.000e+00 1.043e+00 3.443e-01 1.022e+00 L 2.429e-01 -8.286e-01 9.680e-01 0.000e+00 1.043e+00 3.443e-01 1.022e+00 D 3.000e-01 -7.857e-01 9.802e-01 0.000e+00 9.286e-01 3.457e-01 1.002e+00 L 5.571e-01 -1.500e+00 1.007e+00 0.000e+00 1.057e+00 2.886e-01 1.000e+00 P 2.714e-01 -4.571e-01 1.035e+00 0.000e+00 7.857e-01 4.514e-01 1.217e+00 G 5.714e-01 -1.114e+00 1.051e+00 0.000e+00 9.000e-01 3.800e-01 1.107e+00 S 1.429e-01 -8.429e-01 1.050e+00 0.000e+00 7.714e-01 4.414e-01 1.006e+00 L 4.429e-01 -1.500e+00 1.043e+00 2.072e+01 8.857e-01 3.700e-01 8.953e-01 S 2.286e-01 -6.714e-01 1.032e+00 0.000e+00 6.714e-01 4.886e-01 9.010e-01 P -2.857e-02 2.857e-02 1.015e+00 0.000e+00 6.286e-01 5.386e-01 5.101e-01 S -2.857e-02 2.857e-02 1.002e+00 0.000e+00 6.286e-01 5.386e-01 5.101e-01 V 6.571e-01 -1.014e+00 9.884e-01 1.937e+01 9.571e-01 3.443e-01 4.959e-01 I 6.429e-01 -1.400e+00 9.823e-01 2.162e+01 1.114e+00 2.529e-01 3.896e-01 S 3.143e-01 -1.357e+00 9.901e-01 3.601e+00 1.143e+00 2.943e-01 3.990e-01 D 2.714e-01 -1.300e+00 9.981e-01 0.000e+00 1.057e+00 3.114e-01 3.764e-01 N 4.857e-01 -1.957e+00 1.008e+00 4.234e+01 1.100e+00 2.714e-01 3.520e-01 Y 6.714e-01 -2.343e+00 1.014e+00 8.784e+01 1.143e+00 2.600e-01 7.856e-01 G 1.057e+00 -2.786e+00 1.023e+00 8.423e+01 3.914e+00 1.343e-01 8.187e-01 G 5.571e-01 -2.029e+00 1.025e+00 4.865e+01 3.614e+00 3.129e-01 7.423e-01 A 2.714e-01 -9.857e-01 1.022e+00 0.000e+00 3.343e+00 4.757e-01 9.594e-01 K 5.429e-01 -9.000e-01 1.011e+00 7.655e+00 3.257e+00 5.114e-01 9.511e-01 A 4.714e-01 -1.300e+00 9.882e-01 0.000e+00 3.343e+00 4.529e-01 1.022e+00 L 9.000e-01 -1.800e+00 9.788e-01 9.311e+00 6.200e+00 3.100e-01 1.078e+00 T 7.143e-01 -1.414e+00 9.700e-01 0.000e+00 6.157e+00 3.214e-01 6.441e-01 H 2.857e-02 -3.143e-01 9.671e-01 0.000e+00 3.271e+00 5.186e-01 7.219e-01 K 2.857e-02 -3.143e-01 9.667e-01 0.000e+00 3.271e+00 5.186e-01 7.219e-01 I 3.143e-01 -1.357e+00 9.561e-01 0.000e+00 3.543e+00 3.557e-01 5.047e-01 L 4.143e-01 -1.371e+00 9.596e-01 0.000e+00 3.514e+00 3.400e-01 5.074e-01 A 4.143e-01 -6.571e-01 9.714e-01 0.000e+00 3.429e+00 4.371e-01 4.793e-01 N 4.143e-01 -7.429e-01 9.906e-01 0.000e+00 1.771e+00 4.457e-01 4.581e-01 S 1.100e+00 -2.029e+00 1.015e+00 1.316e+01 3.014e+00 2.614e-01 8.836e-01 A 1.786e+00 -3.214e+00 1.029e+00 6.622e+01 4.243e+00 7.286e-02 7.847e-01 R 1.857e+00 -3.529e+00 1.042e+00 8.243e+01 4.243e+00 3.429e-02 7.420e-01 R 2.257e+00 -3.529e+00 1.050e+00 8.604e+01 4.371e+00 2.286e-02 8.419e-01 R 1.957e+00 -2.871e+00 1.051e+00 2.685e+01 4.257e+00 9.429e-02 9.527e-01 G 1.957e+00 -2.871e+00 1.048e+00 2.685e+01 4.257e+00 9.429e-02 9.527e-01 E 1.529e+00 -2.457e+00 1.024e+00 1.701e+01 3.229e+00 1.500e-01 9.369e-01 L 8.429e-01 -1.271e+00 9.964e-01 0.000e+00 2.000e+00 3.386e-01 1.036e+00 A 3.571e-01 -7.286e-01 9.716e-01 0.000e+00 9.143e-01 4.714e-01 1.021e+00 P 4.441e-16 -2.714e-01 9.503e-01 0.000e+00 9.000e-01 5.400e-01 1.027e+00 L -6.857e-01 8.714e-01 9.397e-01 0.000e+00 4.857e-01 7.100e-01 6.201e-01 T -4.286e-01 2.714e-01 9.381e-01 0.000e+00 5.143e-01 6.557e-01 4.867e-01 F -3.571e-01 -4.286e-02 9.511e-01 0.000e+00 5.143e-01 6.171e-01 4.440e-01 I 7.143e-02 -4.571e-01 9.742e-01 0.000e+00 1.543e+00 5.614e-01 4.599e-01 G 7.571e-01 -1.643e+00 1.008e+00 0.000e+00 2.771e+00 3.729e-01 3.610e-01 G 7.429e-01 -1.286e+00 1.038e+00 0.000e+00 2.657e+00 4.129e-01 3.839e-01 R 1.043e+00 -1.786e+00 1.041e+00 1.576e+01 2.786e+00 3.429e-01 3.976e-01 R 1.043e+00 -1.786e+00 1.034e+00 1.576e+01 2.786e+00 3.429e-01 3.976e-01 A 9.857e-01 -1.829e+00 1.020e+00 1.351e+01 2.900e+00 3.414e-01 4.174e-01 T 9.857e-01 -2.000e+00 1.009e+00 1.658e+01 3.071e+00 2.629e-01 4.361e-01 I 4.857e-01 -1.100e+00 1.018e+00 0.000e+00 1.871e+00 4.357e-01 4.443e-01 T 1.000e-01 -5.714e-01 1.024e+00 0.000e+00 7.571e-01 5.529e-01 4.323e-01 P -4.286e-02 -2.286e-01 1.020e+00 0.000e+00 7.143e-01 5.543e-01 4.140e-01 A -3.143e-01 -3.143e-01 9.989e-01 0.000e+00 8.000e-01 5.186e-01 4.223e-01 S -1.286e-01 -7.000e-01 9.614e-01 0.000e+00 8.429e-01 5.071e-01 8.559e-01 V -1.429e-01 -3.429e-01 9.303e-01 0.000e+00 7.286e-01 5.471e-01 8.787e-01 Y -1.000e-01 -2.286e-01 9.145e-01 0.000e+00 6.429e-01 6.086e-01 8.826e-01 A -8.571e-02 -5.857e-01 9.276e-01 5.403e+00 7.571e-01 5.686e-01 8.597e-01 A -3.143e-01 -2.000e-01 9.534e-01 0.000e+00 6.571e-01 6.329e-01 8.084e-01 S 3.286e-01 -1.443e+00 9.749e-01 9.311e+00 1.900e+00 4.586e-01 8.186e-01 T 4.000e-01 -6.143e-01 9.792e-01 0.000e+00 1.657e+00 5.457e-01 3.996e-01 M 4.000e-01 -6.143e-01 9.635e-01 0.000e+00 1.657e+00 5.457e-01 3.996e-01 R 5.143e-01 -9.857e-01 9.429e-01 0.000e+00 1.743e+00 4.900e-01 3.794e-01 I -1.429e-02 -1.000e+00 9.266e-01 0.000e+00 1.657e+00 4.943e-01 3.669e-01 A 4.286e-02 -9.571e-01 9.219e-01 0.000e+00 1.543e+00 4.957e-01 3.470e-01 S -2.857e-02 -6.857e-01 9.248e-01 0.000e+00 1.529e+00 5.029e-01 5.091e-01 W -5.286e-01 2.143e-01 9.273e-01 0.000e+00 3.286e-01 6.757e-01 5.173e-01 G -4.143e-01 -7.143e-02 9.253e-01 0.000e+00 3.143e-01 6.514e-01 9.173e-01 L 8.571e-02 -9.714e-01 9.279e-01 0.000e+00 1.514e+00 4.786e-01 9.091e-01 A 4.714e-01 -1.500e+00 9.344e-01 0.000e+00 2.629e+00 3.614e-01 9.211e-01 C 1.386e+00 -2.014e+00 9.513e-01 0.000e+00 3.829e+00 2.400e-01 9.457e-01 R 1.129e+00 -1.314e+00 9.721e-01 0.000e+00 3.786e+00 2.900e-01 5.549e-01 R 1.029e+00 -1.457e+00 9.791e-01 0.000e+00 3.800e+00 3.043e-01 4.276e-01 R 6.143e-01 -1.843e+00 9.667e-01 0.000e+00 3.800e+00 2.529e-01 3.949e-01 I 5.000e-01 -1.657e+00 9.416e-01 0.000e+00 3.829e+00 2.814e-01 5.191e-01 F 7.143e-02 -1.243e+00 9.181e-01 0.000e+00 2.800e+00 3.371e-01 5.033e-01 W -4.286e-01 -3.429e-01 9.037e-01 0.000e+00 1.600e+00 5.100e-01 5.114e-01 L -1.114e+00 9.429e-01 9.096e-01 0.000e+00 3.571e-01 6.943e-01 8.600e-02 P -4.286e-01 -3.429e-01 9.238e-01 0.000e+00 1.600e+00 5.100e-01 5.114e-01 A 3.571e-01 -1.300e+00 9.449e-01 0.000e+00 4.471e+00 2.986e-01 5.610e-01 I 7.714e-01 -9.143e-01 9.700e-01 0.000e+00 4.471e+00 3.500e-01 5.937e-01 R 9.714e-01 -1.557e+00 9.921e-01 0.000e+00 4.614e+00 2.943e-01 4.801e-01 K 7.143e-01 -7.857e-01 1.006e+00 0.000e+00 4.414e+00 4.271e-01 5.949e-01 A 1.214e+00 -1.686e+00 1.008e+00 0.000e+00 5.614e+00 2.543e-01 5.867e-01 T 1.414e+00 -2.429e+00 1.004e+00 4.054e+01 5.771e+00 2.029e-01 9.974e-01 L 9.143e-01 -1.529e+00 9.979e-01 1.017e+01 4.571e+00 3.757e-01 1.006e+00 R 3.429e-01 -6.143e-01 9.903e-01 0.000e+00 1.657e+00 5.443e-01 9.590e-01 T 8.429e-01 -1.514e+00 9.861e-01 0.000e+00 2.857e+00 3.714e-01 9.509e-01 A 9.429e-01 -1.529e+00 9.887e-01 0.000e+00 2.829e+00 3.557e-01 9.536e-01 C 1.200e+00 -2.129e+00 9.965e-01 6.171e+01 2.857e+00 3.014e-01 8.201e-01 R 5.143e-01 -9.429e-01 1.015e+00 1.349e+00 1.629e+00 4.900e-01 9.190e-01 S 5.000e-01 -5.857e-01 1.025e+00 0.000e+00 1.514e+00 5.300e-01 9.419e-01 G 5.000e-01 -5.857e-01 1.014e+00 0.000e+00 1.514e+00 5.300e-01 9.419e-01 L 1.071e+00 -1.586e+00 9.958e-01 0.000e+00 2.771e+00 3.700e-01 9.673e-01 A 1.071e+00 -1.586e+00 9.773e-01 0.000e+00 2.771e+00 3.700e-01 9.673e-01 A 1.457e+00 -2.114e+00 9.758e-01 3.281e-01 3.886e+00 2.529e-01 9.793e-01 R 1.314e+00 -1.700e+00 9.839e-01 0.000e+00 3.829e+00 2.786e-01 9.884e-01 R 1.429e+00 -1.886e+00 9.836e-01 1.802e+01 3.800e+00 2.500e-01 8.641e-01 R 1.929e+00 -2.786e+00 9.779e-01 2.748e+01 5.000e+00 7.714e-02 8.560e-01 C 2.000e+00 -3.100e+00 9.645e-01 4.369e+01 5.000e+00 3.857e-02 8.133e-01 C 1.243e+00 -2.643e+00 9.586e-01 1.621e+01 4.000e+00 1.357e-01 8.069e-01 R 5.571e-01 -1.457e+00 9.648e-01 0.000e+00 2.771e+00 3.243e-01 9.057e-01 G -1.286e-01 -2.714e-01 9.674e-01 0.000e+00 1.543e+00 5.129e-01 1.005e+00 Y -4.286e-02 -7.286e-01 9.698e-01 0.000e+00 1.714e+00 4.857e-01 1.015e+00 L 5.286e-01 -1.729e+00 9.756e-01 0.000e+00 2.971e+00 3.257e-01 1.041e+00 L 5.286e-01 -1.729e+00 9.854e-01 0.000e+00 2.971e+00 3.257e-01 1.041e+00 T 2.000e-01 -1.857e+00 9.994e-01 2.300e+01 3.171e+00 2.886e-01 1.069e+00 R 5.286e-01 -1.900e+00 1.005e+00 2.086e+01 3.143e+00 2.471e-01 1.059e+00 R 3.000e-01 -2.571e+00 9.976e-01 3.583e+01 3.171e+00 1.800e-01 9.360e-01 Y 9.857e-01 -3.671e+00 9.864e-01 7.989e+01 6.057e+00 -1.714e-02 8.583e-01 P 1.043e+00 -3.629e+00 9.804e-01 5.936e+01 5.943e+00 -1.571e-02 8.384e-01 W 3.571e-01 -2.443e+00 9.836e-01 1.616e+01 4.714e+00 1.729e-01 9.373e-01 K -2.143e-01 -1.443e+00 9.938e-01 0.000e+00 3.457e+00 3.329e-01 9.119e-01 G 4.286e-02 -1.000e+00 9.922e-01 0.000e+00 3.257e+00 4.086e-01 9.264e-01 L 4.286e-02 -8.286e-01 9.781e-01 0.000e+00 3.086e+00 4.871e-01 9.077e-01 C 3.857e-01 -3.429e-01 9.621e-01 0.000e+00 3.029e+00 5.257e-01 9.069e-01 A 3.857e-01 -4.286e-01 9.525e-01 0.000e+00 1.371e+00 5.343e-01 8.857e-01 G 8.143e-01 -1.014e+00 9.566e-01 0.000e+00 2.571e+00 4.000e-01 9.203e-01 C 5.857e-01 -1.686e+00 9.677e-01 0.000e+00 2.600e+00 3.329e-01 7.969e-01 R 5.143e-01 -1.443e+00 9.768e-01 1.171e+01 2.614e+00 3.471e-01 8.121e-01 R 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 W 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 V 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00 0.000e+00
gbiowstest-pcprof.py
#!/usr/bin/env python
# ================================================================================
#
# COPYRIGHT NOTICE
#
# Centre National de la Recherche Scientifique
# CNRS
#
# Institut de Biologie et Chimie des Proteines
# IBCP CNRS UMR 5086
# 7 passage du Vercors
# 69007 Lyon, FRANCE
#
# This software/database is covered by copyright of CNRS IBCP
# All rights reserved. Reproduction and usage of this software/database are
# strictly restricted, and need a prior written permission from CNRS IBCP
# (see "Contact" below).
#
# CNRS IBCP do not and cannot warrant the performance or results that
# may be obtained by using this software or data. CNRS IBCP disclaim all
# warranties, express or implied, including warranties of performance,
# merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date: 18/11/2008
#
# $Revision: 1.0 $
#
# File Description:
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date Name Description of modification
# ------- ---------- -----------------------------------------------------
#
# ================================================================================
import sys
import time
from PcProf_Service_client import *
fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.PcProf'
ret = 0
# get a port proxy instance
loc = PcProf_ServiceLocator()
port = loc.getPcProfPort()
###
# submit a new request
# create
req = submitPcProfRequest()
fp_input = open (fn_input, 'r')
req._Sequence = fp_input.read()
# call the remote method
resp = port.submitPcProf(req)
jobid = resp._JobId
#print jobid
if not jobid:
ret = 1
###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusPcProfRequest()
req._JobId = jobid
while status not in ('done','aborted'):
time.sleep(2)
resp = port.checkStatusPcProf(req)
status = resp._Status
#print status
if status != 'done':
ret = 1
###
# get results
req = getResultsPcProfRequest()
req._JobId = jobid
resp = port.getResultsPcProf(req)
# write result
#open(fn_control,'w').write(resp._PhysicoChemProfile)
#compare result with ref
resultcontrol = open(fn_control, 'r').read()
if resp._PhysicoChemProfile != resultcontrol:
ret = 1
#print "wooohh"
#print ret
sys.exit (ret)
PcProf_Service_client.py
##################################################
# file: PcProf_Service_client.py
#
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
# /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/PcProfWS.wsdl
#
##################################################
import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI
# Locator
class PcProf_ServiceLocator:
PcProfPort_address = "http://gbio.ibcp.fr:8090/PcProf_Service"
def getPcProfPortAddress(self):
return PcProf_ServiceLocator.PcProfPort_address
def getPcProfPort(self, url=None, **kw):
return PcProfBindingSOAP(url or PcProf_ServiceLocator.PcProfPort_address, **kw)
# Methods
class PcProfBindingSOAP:
def __init__(self, url, **kw):
kw.setdefault("readerclass", None)
kw.setdefault("writerclass", None)
# no resource properties
self.binding = client.Binding(url=url, **kw)
# no ws-addressing
# op: submitPcProf
def submitPcProf(self, request, **kw):
if isinstance(request, submitPcProfRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#submitPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=submitPcProfResponse.typecode.ofwhat, pyclass=submitPcProfResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: checkStatusPcProf
def checkStatusPcProf(self, request, **kw):
if isinstance(request, checkStatusPcProfRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#checkStatusPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=checkStatusPcProfResponse.typecode.ofwhat, pyclass=checkStatusPcProfResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: getResultsPcProf
def getResultsPcProf(self, request, **kw):
if isinstance(request, getResultsPcProfRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#getResultsPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=getResultsPcProfResponse.typecode.ofwhat, pyclass=getResultsPcProfResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: cancelPcProf
def cancelPcProf(self, request, **kw):
if isinstance(request, cancelPcProfRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#cancelPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=cancelPcProfResponse.typecode.ofwhat, pyclass=cancelPcProfResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
class submitPcProfRequest:
def __init__(self, **kw):
"""Keyword parameters:
Sequence -- part Sequence
"""
self._Sequence = kw.get("Sequence")
submitPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","submitPcProf"), ofwhat=[ZSI.TC.String(pname="Sequence", aname="_Sequence", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitPcProfRequest, encoded="urn:PcProf_Service")
class submitPcProfResponse:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
submitPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","submitPcProfResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitPcProfResponse, encoded="urn:PcProf_Service")
class checkStatusPcProfRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
checkStatusPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","checkStatusPcProf"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusPcProfRequest, encoded="urn:PcProf_Service")
class checkStatusPcProfResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
checkStatusPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","checkStatusPcProfResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusPcProfResponse, encoded="urn:PcProf_Service")
class getResultsPcProfRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
getResultsPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","getResultsPcProf"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsPcProfRequest, encoded="urn:PcProf_Service")
class getResultsPcProfResponse:
def __init__(self, **kw):
"""Keyword parameters:
PhysicoChemProfile -- part PhysicoChemProfile
"""
self._PhysicoChemProfile = kw.get("PhysicoChemProfile")
getResultsPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","getResultsPcProfResponse"), ofwhat=[ZSI.TC.String(pname="PhysicoChemProfile", aname="_PhysicoChemProfile", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsPcProfResponse, encoded="urn:PcProf_Service")
class cancelPcProfRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
cancelPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","cancelPcProf"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelPcProfRequest, encoded="urn:PcProf_Service")
class cancelPcProfResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
cancelPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","cancelPcProfResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelPcProfResponse, encoded="urn:PcProf_Service")
PcProf_Service_client.pyc (binary file)
PcProf_Service_types.py
################################################## # file: PcProf_Service_types.py # # schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule" # /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/PcProfWS.wsdl # ################################################## import ZSI import ZSI.TCcompound from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED
»
- Login to post comments