Functional test

This is a test of the COILS predict protein coiled-coil regions (CNRS IBCP) service.

Test filesDownload the files for this test

Test runRun test now

Support reference#274-284

Show/hide recent test logs

This test consists of the following files:

__MACOSX/

benchy_seq001.seq

>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009)
MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR
SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ
VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR
RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG
LAARRRCCRGYLLTRRYPWKGLCAGCRRWV

Coils_Service_client.py

##################################################
# file: Coils_Service_client.py
# 
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#     /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/CoilsWS.wsdl
# 
##################################################


import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI

# Locator
class Coils_ServiceLocator:
    CoilsPort_address = "http://gbio.ibcp.fr:8090/Coils_Service"
    def getCoilsPortAddress(self):
        return Coils_ServiceLocator.CoilsPort_address
    def getCoilsPort(self, url=None, **kw):
        return CoilsBindingSOAP(url or Coils_ServiceLocator.CoilsPort_address, **kw)

# Methods
class CoilsBindingSOAP:
    def __init__(self, url, **kw):
        kw.setdefault("readerclass", None)
        kw.setdefault("writerclass", None)
        # no resource properties
        self.binding = client.Binding(url=url, **kw)
        # no ws-addressing

    # op: submitCoils
    def submitCoils(self, request, **kw):
        if isinstance(request, submitCoilsRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#submitCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=submitCoilsResponse.typecode.ofwhat, pyclass=submitCoilsResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: checkStatusCoils
    def checkStatusCoils(self, request, **kw):
        if isinstance(request, checkStatusCoilsRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#checkStatusCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=checkStatusCoilsResponse.typecode.ofwhat, pyclass=checkStatusCoilsResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: getResultsCoils
    def getResultsCoils(self, request, **kw):
        if isinstance(request, getResultsCoilsRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#getResultsCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=getResultsCoilsResponse.typecode.ofwhat, pyclass=getResultsCoilsResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: cancelCoils
    def cancelCoils(self, request, **kw):
        if isinstance(request, cancelCoilsRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#cancelCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=cancelCoilsResponse.typecode.ofwhat, pyclass=cancelCoilsResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

class submitCoilsRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        Sequences -- part Sequences
        """
        self._Sequences =  kw.get("Sequences")
submitCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","submitCoils"), ofwhat=[ZSI.TC.String(pname="Sequences", aname="_Sequences", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitCoilsRequest, encoded="urn:Coils_Service")

class submitCoilsResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
submitCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","submitCoilsResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitCoilsResponse, encoded="urn:Coils_Service")

class checkStatusCoilsRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
checkStatusCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","checkStatusCoils"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusCoilsRequest, encoded="urn:Coils_Service")

class checkStatusCoilsResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
checkStatusCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","checkStatusCoilsResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusCoilsResponse, encoded="urn:Coils_Service")

class getResultsCoilsRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
getResultsCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","getResultsCoils"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsCoilsRequest, encoded="urn:Coils_Service")

class getResultsCoilsResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        CoiledCoils -- part CoiledCoils
        """
        self._CoiledCoils =  kw.get("CoiledCoils")
getResultsCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","getResultsCoilsResponse"), ofwhat=[ZSI.TC.String(pname="CoiledCoils", aname="_CoiledCoils", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsCoilsResponse, encoded="urn:Coils_Service")

class cancelCoilsRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
cancelCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","cancelCoils"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelCoilsRequest, encoded="urn:Coils_Service")

class cancelCoilsResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
cancelCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","cancelCoilsResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelCoilsResponse, encoded="urn:Coils_Service")

Coils_Service_client.pyc (binary file)

Coils_Service_types.py

##################################################
# file: Coils_Service_types.py
#
# schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#    /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/CoilsWS.wsdl
#
##################################################

import ZSI
import ZSI.TCcompound
from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED

control-seq001.Coils

1 M a   0.581   0.000 (  0.000   1.976)
   2 K a   0.855   0.000 (  0.003   4.761)
   3 K b   0.855   0.000 (  0.003   4.761)
   4 I c   0.855   0.000 (  0.003   4.761)
   5 T d   0.855   0.000 (  0.003   4.761)
   6 I e   0.855   0.000 (  0.003   4.761)
   7 Y a   0.876   0.000 (  0.004   4.749)
   8 D b   0.876   0.000 (  0.004   4.749)
   9 L c   0.876   0.000 (  0.004   4.749)
  10 A d   0.876   0.000 (  0.004   4.749)
  11 E e   0.876   0.000 (  0.004   4.749)
  12 L f   0.876   0.000 (  0.004   4.749)
  13 S g   0.876   0.000 (  0.004   4.749)
  14 G a   0.876   0.000 (  0.004   4.749)
  15 V b   0.876   0.000 (  0.004   4.749)
  16 S a   0.878   0.000 (  0.004   4.744)
  17 A b   0.878   0.000 (  0.004   4.744)
  18 S c   0.878   0.000 (  0.004   4.744)
  19 A a   0.881   0.000 (  0.004   4.739)
  20 V a   0.907   0.000 (  0.006   4.642)
  21 S b   0.907   0.000 (  0.006   4.642)
  22 A c   0.907   0.000 (  0.006   4.642)
  23 I a   0.993   0.000 (  0.022   3.900)
  24 L b   0.993   0.000 (  0.022   3.900)
  25 N c   0.993   0.000 (  0.022   3.900)
  26 G d   0.993   0.000 (  0.022   3.900)
  27 N a   1.080   0.001 (  0.071   2.745)
  28 W b   1.080   0.001 (  0.071   2.745)
  29 K c   1.080   0.001 (  0.071   2.745)
  30 K a   1.117   0.002 (  0.111   2.253)
  31 R b   1.117   0.002 (  0.111   2.253)
  32 R c   1.117   0.002 (  0.111   2.253)
  33 I d   1.117   0.002 (  0.111   2.253)
  34 S e   1.117   0.002 (  0.111   2.253)
  35 A f   1.117   0.002 (  0.111   2.253)
  36 K g   1.117   0.002 (  0.111   2.253)
  37 L a   1.117   0.002 (  0.111   2.253)
  38 A b   1.117   0.002 (  0.111   2.253)
  39 E c   1.117   0.002 (  0.111   2.253)
  40 K d   1.117   0.002 (  0.111   2.253)
  41 V e   1.117   0.002 (  0.111   2.253)
  42 T f   1.117   0.002 (  0.111   2.253)
  43 R g   1.117   0.002 (  0.111   2.253)
  44 I a   1.117   0.002 (  0.111   2.253)
  45 A b   1.117   0.002 (  0.111   2.253)
  46 E c   1.117   0.002 (  0.111   2.253)
  47 E d   1.117   0.002 (  0.111   2.253)
  48 Q e   1.117   0.002 (  0.111   2.253)
  49 G f   1.117   0.002 (  0.111   2.253)
  50 Y g   1.117   0.002 (  0.111   2.253)
  51 A c   1.043   0.001 (  0.044   3.260)
  52 I d   1.043   0.001 (  0.044   3.260)
  53 N e   1.043   0.001 (  0.044   3.260)
  54 R f   1.043   0.001 (  0.044   3.260)
  55 Q g   1.043   0.001 (  0.044   3.260)
  56 A a   1.022   0.000 (  0.033   3.538)
  57 S b   1.022   0.000 (  0.033   3.538)
  58 M c   1.022   0.000 (  0.033   3.538)
  59 L d   1.022   0.000 (  0.033   3.538)
  60 R e   1.022   0.000 (  0.033   3.538)
  61 S f   1.022   0.000 (  0.033   3.538)
  62 K g   1.022   0.000 (  0.033   3.538)
  63 K e   0.954   0.000 (  0.013   4.309)
  64 S f   0.954   0.000 (  0.013   4.309)
  65 H g   0.954   0.000 (  0.013   4.309)
  66 V d   0.796   0.000 (  0.001   4.546)
  67 I e   0.796   0.000 (  0.001   4.546)
  68 G f   0.796   0.000 (  0.001   4.546)
  69 M g   0.796   0.000 (  0.001   4.546)
  70 I a   0.713   0.000 (  0.000   3.731)
  71 I a   0.828   0.000 (  0.002   4.708)
  72 P b   0.828   0.000 (  0.002   4.708)
  73 K c   0.828   0.000 (  0.002   4.708)
  74 Y d   0.828   0.000 (  0.002   4.708)
  75 D e   0.828   0.000 (  0.002   4.708)
  76 N f   0.828   0.000 (  0.002   4.708)
  77 R g   0.828   0.000 (  0.002   4.708)
  78 Y a   0.828   0.000 (  0.002   4.708)
  79 F b   0.828   0.000 (  0.002   4.708)
  80 G c   0.828   0.000 (  0.002   4.708)
  81 S d   0.828   0.000 (  0.002   4.708)
  82 I a   0.880   0.000 (  0.004   4.741)
  83 A b   0.880   0.000 (  0.004   4.741)
  84 E c   0.880   0.000 (  0.004   4.741)
  85 R d   0.880   0.000 (  0.004   4.741)
  86 F e   0.880   0.000 (  0.004   4.741)
  87 E f   0.880   0.000 (  0.004   4.741)
  88 E g   0.880   0.000 (  0.004   4.741)
  89 M a   0.880   0.000 (  0.004   4.741)
  90 A b   0.880   0.000 (  0.004   4.741)
  91 R c   0.880   0.000 (  0.004   4.741)
  92 E d   0.880   0.000 (  0.004   4.741)
  93 R e   0.880   0.000 (  0.004   4.741)
  94 G f   0.880   0.000 (  0.004   4.741)
  95 L g   0.880   0.000 (  0.004   4.741)
  96 L a   0.880   0.000 (  0.004   4.741)
  97 P b   0.880   0.000 (  0.004   4.741)
  98 I a   1.044   0.001 (  0.045   3.242)
  99 I b   1.044   0.001 (  0.045   3.242)
 100 T c   1.044   0.001 (  0.045   3.242)
 101 C d   1.044   0.001 (  0.045   3.242)
 102 T e   1.044   0.001 (  0.045   3.242)
 103 R f   1.044   0.001 (  0.045   3.242)
 104 R g   1.044   0.001 (  0.045   3.242)
 105 R a   1.044   0.001 (  0.045   3.242)
 106 P b   1.044   0.001 (  0.045   3.242)
 107 E c   1.044   0.001 (  0.045   3.242)
 108 L d   1.044   0.001 (  0.045   3.242)
 109 E e   1.044   0.001 (  0.045   3.242)
 110 I f   1.044   0.001 (  0.045   3.242)
 111 E g   1.044   0.001 (  0.045   3.242)
 112 A a   1.044   0.001 (  0.045   3.242)
 113 V b   1.044   0.001 (  0.045   3.242)
 114 K c   1.044   0.001 (  0.045   3.242)
 115 A d   1.044   0.001 (  0.045   3.242)
 116 M e   1.044   0.001 (  0.045   3.242)
 117 L f   1.044   0.001 (  0.045   3.242)
 118 S g   1.044   0.001 (  0.045   3.242)
 119 W f   0.821   0.000 (  0.001   4.680)
 120 Q g   0.821   0.000 (  0.001   4.680)
 121 V a   0.821   0.000 (  0.001   4.680)
 122 D b   0.821   0.000 (  0.001   4.680)
 123 W c   0.821   0.000 (  0.001   4.680)
 124 V d   0.821   0.000 (  0.001   4.680)
 125 V e   0.821   0.000 (  0.001   4.680)
 126 A f   0.821   0.000 (  0.001   4.680)
 127 T g   0.821   0.000 (  0.001   4.680)
 128 G f   0.712   0.000 (  0.000   3.718)
 129 A g   0.712   0.000 (  0.000   3.718)
 130 T g   0.709   0.000 (  0.000   3.679)
 131 N d   0.657   0.000 (  0.000   2.981)
 132 P e   0.657   0.000 (  0.000   2.981)
 133 D f   0.657   0.000 (  0.000   2.981)
 134 K g   0.657   0.000 (  0.000   2.981)
 135 I a   0.657   0.000 (  0.000   2.981)
 136 S b   0.657   0.000 (  0.000   2.981)
 137 A c   0.657   0.000 (  0.000   2.981)
 138 L d   0.657   0.000 (  0.000   2.981)
 139 C e   0.657   0.000 (  0.000   2.981)
 140 Q f   0.657   0.000 (  0.000   2.981)
 141 Q g   0.657   0.000 (  0.000   2.981)
 142 A d   0.545   0.000 (  0.000   1.549)
 143 G e   0.545   0.000 (  0.000   1.549)
 144 V f   0.545   0.000 (  0.000   1.549)
 145 P g   0.545   0.000 (  0.000   1.549)
 146 T c   0.542   0.000 (  0.000   1.512)
 147 V d   0.542   0.000 (  0.000   1.512)
 148 N e   0.542   0.000 (  0.000   1.512)
 149 L f   0.542   0.000 (  0.000   1.512)
 150 D g   0.542   0.000 (  0.000   1.512)
 151 L c   0.537   0.000 (  0.000   1.454)
 152 P d   0.537   0.000 (  0.000   1.454)
 153 G e   0.537   0.000 (  0.000   1.454)
 154 S f   0.537   0.000 (  0.000   1.454)
 155 L g   0.537   0.000 (  0.000   1.454)
 156 S a   0.554   0.000 (  0.000   1.645)
 157 P a   0.677   0.000 (  0.000   3.251)
 158 S b   0.677   0.000 (  0.000   3.251)
 159 V c   0.677   0.000 (  0.000   3.251)
 160 I a   0.824   0.000 (  0.002   4.691)
 161 S a   0.867   0.000 (  0.003   4.759)
 162 D b   0.867   0.000 (  0.003   4.759)
 163 N c   0.867   0.000 (  0.003   4.759)
 164 Y d   0.867   0.000 (  0.003   4.759)
 165 G e   0.867   0.000 (  0.003   4.759)
 166 G f   0.867   0.000 (  0.003   4.759)
 167 A g   0.867   0.000 (  0.003   4.759)
 168 K a   0.867   0.000 (  0.003   4.759)
 169 A b   0.867   0.000 (  0.003   4.759)
 170 L c   0.867   0.000 (  0.003   4.759)
 171 T d   0.867   0.000 (  0.003   4.759)
 172 H e   0.867   0.000 (  0.003   4.759)
 173 K f   0.867   0.000 (  0.003   4.759)
 174 I g   0.867   0.000 (  0.003   4.759)
 175 L a   0.867   0.000 (  0.003   4.759)
 176 A b   0.867   0.000 (  0.003   4.759)
 177 N c   0.867   0.000 (  0.003   4.759)
 178 S d   0.867   0.000 (  0.003   4.759)
 179 A e   0.867   0.000 (  0.003   4.759)
 180 R f   0.867   0.000 (  0.003   4.759)
 181 R g   0.867   0.000 (  0.003   4.759)
 182 R e   0.839   0.000 (  0.002   4.737)
 183 G f   0.839   0.000 (  0.002   4.737)
 184 E g   0.839   0.000 (  0.002   4.737)
 185 L f   0.812   0.000 (  0.001   4.637)
 186 A g   0.812   0.000 (  0.001   4.637)
 187 P g   0.790   0.000 (  0.001   4.505)
 188 L f   0.752   0.000 (  0.000   4.177)
 189 T g   0.752   0.000 (  0.000   4.177)
 190 F a   0.695   0.000 (  0.000   3.501)
 191 I b   0.695   0.000 (  0.000   3.501)
 192 G c   0.695   0.000 (  0.000   3.501)
 193 G d   0.695   0.000 (  0.000   3.501)
 194 R e   0.695   0.000 (  0.000   3.501)
 195 R f   0.695   0.000 (  0.000   3.501)
 196 A g   0.695   0.000 (  0.000   3.501)
 197 T g   0.600   0.000 (  0.000   2.210)
 198 I a   0.600   0.000 (  0.000   2.210)
 199 T b   0.600   0.000 (  0.000   2.210)
 200 P c   0.600   0.000 (  0.000   2.210)
 201 A d   0.600   0.000 (  0.000   2.210)
 202 S a   0.618   0.000 (  0.000   2.448)
 203 V b   0.618   0.000 (  0.000   2.448)
 204 Y c   0.618   0.000 (  0.000   2.448)
 205 A d   0.618   0.000 (  0.000   2.448)
 206 A e   0.618   0.000 (  0.000   2.448)
 207 S f   0.618   0.000 (  0.000   2.448)
 208 T g   0.618   0.000 (  0.000   2.448)
 209 M a   0.618   0.000 (  0.000   2.448)
 210 R b   0.618   0.000 (  0.000   2.448)
 211 I c   0.618   0.000 (  0.000   2.448)
 212 A d   0.618   0.000 (  0.000   2.448)
 213 S e   0.618   0.000 (  0.000   2.448)
 214 W f   0.618   0.000 (  0.000   2.448)
 215 G g   0.618   0.000 (  0.000   2.448)
 216 L a   0.618   0.000 (  0.000   2.448)
 217 A b   0.618   0.000 (  0.000   2.448)
 218 C c   0.618   0.000 (  0.000   2.448)
 219 R d   0.618   0.000 (  0.000   2.448)
 220 R e   0.618   0.000 (  0.000   2.448)
 221 R f   0.618   0.000 (  0.000   2.448)
 222 I g   0.618   0.000 (  0.000   2.448)
 223 F a   0.596   0.000 (  0.000   2.166)
 224 W b   0.596   0.000 (  0.000   2.166)
 225 L a   0.747   0.000 (  0.000   4.116)
 226 P b   0.747   0.000 (  0.000   4.116)
 227 A c   0.747   0.000 (  0.000   4.116)
 228 I d   0.747   0.000 (  0.000   4.116)
 229 R e   0.747   0.000 (  0.000   4.116)
 230 K a   0.814   0.000 (  0.001   4.650)
 231 A b   0.814   0.000 (  0.001   4.650)
 232 T c   0.814   0.000 (  0.001   4.650)
 233 L d   0.814   0.000 (  0.001   4.650)
 234 R e   0.814   0.000 (  0.001   4.650)
 235 T f   0.814   0.000 (  0.001   4.650)
 236 A g   0.814   0.000 (  0.001   4.650)
 237 C a   0.814   0.000 (  0.001   4.650)
 238 R b   0.814   0.000 (  0.001   4.650)
 239 S c   0.814   0.000 (  0.001   4.650)
 240 G d   0.814   0.000 (  0.001   4.650)
 241 L e   0.814   0.000 (  0.001   4.650)
 242 A f   0.814   0.000 (  0.001   4.650)
 243 A g   0.814   0.000 (  0.001   4.650)
 244 R a   0.814   0.000 (  0.001   4.650)
 245 R b   0.814   0.000 (  0.001   4.650)
 246 R c   0.814   0.000 (  0.001   4.650)
 247 C d   0.814   0.000 (  0.001   4.650)
 248 C e   0.814   0.000 (  0.001   4.650)
 249 R f   0.814   0.000 (  0.001   4.650)
 250 G g   0.814   0.000 (  0.001   4.650)
 251 Y d   0.723   0.000 (  0.000   3.846)
 252 L e   0.723   0.000 (  0.000   3.846)
 253 L f   0.723   0.000 (  0.000   3.846)
 254 T g   0.723   0.000 (  0.000   3.846)
 255 R e   0.643   0.000 (  0.000   2.790)
 256 R f   0.643   0.000 (  0.000   2.790)
 257 Y g   0.643   0.000 (  0.000   2.790)
 258 P g   0.532   0.000 (  0.000   1.409)
 259 W d   0.490   0.000 (  0.000   1.008)
 260 K e   0.490   0.000 (  0.000   1.008)
 261 G f   0.490   0.000 (  0.000   1.008)
 262 L g   0.490   0.000 (  0.000   1.008)
 263 C a   0.476   0.000 (  0.000   0.898)
 264 A b   0.476   0.000 (  0.000   0.898)
 265 G c   0.476   0.000 (  0.000   0.898)
 266 C d   0.476   0.000 (  0.000   0.898)
 267 R e   0.476   0.000 (  0.000   0.898)
 268 R f   0.476   0.000 (  0.000   0.898)
 269 W g   0.476   0.000 (  0.000   0.898)
 270 V g   0.368   0.000 (  0.000   0.305)

gbiowstest-coils.py

#!/usr/bin/env python
# ================================================================================
#
#                             COPYRIGHT NOTICE
#
#                Centre National de la Recherche Scientifique
#                                   CNRS
#
#                Institut de Biologie et Chimie des Proteines
#                             IBCP CNRS UMR 5086
#                            7 passage du Vercors
#                             69007 Lyon, FRANCE
#
#  This software/database is covered by copyright of CNRS IBCP
#  All rights reserved. Reproduction and usage of this software/database are 
#  strictly restricted, and need a prior written permission from CNRS IBCP
#  (see "Contact" below).
#
#  CNRS IBCP do not and cannot warrant the performance or results that
#  may be obtained by using this software or data. CNRS IBCP disclaim all
#  warranties, express or implied, including warranties of performance,
#  merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date:   18/11/2008
#
# $Revision: 1.0 $
#
# File Description: 
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date     Name        Description of modification
# -------  ----------  -----------------------------------------------------
#
# ================================================================================
import sys
import time
from Coils_Service_client import *

fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.Coils'
ret = 0

# get a port proxy instance
loc = Coils_ServiceLocator()
port = loc.getCoilsPort()

###
# submit a new request
# create
req = submitCoilsRequest()
fp_input = open (fn_input, 'r')
req._Sequences = fp_input.read()

# call the remote method
resp = port.submitCoils(req)
jobid = resp._JobId
#print jobid
if not jobid:
	ret = 1

###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusCoilsRequest()
req._JobId = jobid
while status not in ('done','aborted'):
	time.sleep(2) 
	resp = port.checkStatusCoils(req)
	status = resp._Status
	#print status
if status != 'done':
	ret = 1

###
# get results
req = getResultsCoilsRequest()
req._JobId = jobid
resp = port.getResultsCoils(req)

# write result
#open(fn_control,'w').write(resp._CoiledCoils)

#compare result with ref
resultcontrol = open(fn_control, 'r').read()
if resp._CoiledCoils != resultcontrol:
	ret = 1
	#print "wooohh"

#print ret
sys.exit (ret)

Submitted by cblanchet on Thu, 01/15/2009 - 15:48