Functional test

This is a test of the COILS predict protein coiled-coil regions (CNRS IBCP) service.
Test filesDownload the files for this test
Test runRun test now
Support reference#274-284
Show/hide recent test logs
view log 2 weeks agoPASSED

Test began: 2010-08-17 17:09:22 Test ended: 2010-08-17 17:09:25 Result : Test passedDownload this log...
view log 3 weeks agoPASSED

Test began: 2010-08-15 10:16:06 Test ended: 2010-08-15 10:16:12 Result : Test passedDownload this log...
view log 4 months agoPASSED

Test began: 2010-04-27 02:32:03 Test ended: 2010-04-27 02:32:10 Result : Test passedDownload this log...
view log 4 months agoPASSED

Test began: 2010-04-21 11:04:49 Test ended: 2010-04-21 11:04:56 Result : Test passedDownload this log...
view log 5 months agoPASSED

Test began: 2010-04-17 11:12:17 Test ended: 2010-04-17 11:12:22 Result : Test passedDownload this log...
view log 6 months agoPASSED

Test began: 2010-03-15 17:27:01 Test ended: 2010-03-15 17:27:06 Result : Test passedDownload this log...
view log 6 months agoPASSED

Test began: 2010-02-27 11:07:56 Test ended: 2010-02-27 11:08:11 Result : Test passedDownload this log...
view log 7 months agoPASSED

Test began: 2010-02-16 01:39:17 Test ended: 2010-02-16 01:39:28 Result : Test passedDownload this log...
view log 7 months agoPASSED

Test began: 2010-02-08 16:37:28 Test ended: 2010-02-08 16:37:32 Result : Test passedDownload this log...
view log 7 months agoPASSED

Test began: 2010-02-06 04:11:54 Test ended: 2010-02-06 04:11:59 Result : Test passedDownload this log...
This test consists of the following files:
__MACOSX/
._gbiowstest-coils.py (binary file)
benchy_seq001.seq
>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009) MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG LAARRRCCRGYLLTRRYPWKGLCAGCRRWV
Coils_Service_client.py
##################################################
# file: Coils_Service_client.py
#
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
# /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/CoilsWS.wsdl
#
##################################################
import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI
# Locator
class Coils_ServiceLocator:
CoilsPort_address = "http://gbio.ibcp.fr:8090/Coils_Service"
def getCoilsPortAddress(self):
return Coils_ServiceLocator.CoilsPort_address
def getCoilsPort(self, url=None, **kw):
return CoilsBindingSOAP(url or Coils_ServiceLocator.CoilsPort_address, **kw)
# Methods
class CoilsBindingSOAP:
def __init__(self, url, **kw):
kw.setdefault("readerclass", None)
kw.setdefault("writerclass", None)
# no resource properties
self.binding = client.Binding(url=url, **kw)
# no ws-addressing
# op: submitCoils
def submitCoils(self, request, **kw):
if isinstance(request, submitCoilsRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#submitCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=submitCoilsResponse.typecode.ofwhat, pyclass=submitCoilsResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: checkStatusCoils
def checkStatusCoils(self, request, **kw):
if isinstance(request, checkStatusCoilsRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#checkStatusCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=checkStatusCoilsResponse.typecode.ofwhat, pyclass=checkStatusCoilsResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: getResultsCoils
def getResultsCoils(self, request, **kw):
if isinstance(request, getResultsCoilsRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#getResultsCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=getResultsCoilsResponse.typecode.ofwhat, pyclass=getResultsCoilsResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
# op: cancelCoils
def cancelCoils(self, request, **kw):
if isinstance(request, cancelCoilsRequest) is False:
raise TypeError, "%s incorrect request type" % (request.__class__)
# no input wsaction
self.binding.Send(None, None, request, soapaction="urn:CoilsWS.wsdl#cancelCoils", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
# no output wsaction
typecode = Struct(pname=None, ofwhat=cancelCoilsResponse.typecode.ofwhat, pyclass=cancelCoilsResponse.typecode.pyclass)
response = self.binding.Receive(typecode)
return response
class submitCoilsRequest:
def __init__(self, **kw):
"""Keyword parameters:
Sequences -- part Sequences
"""
self._Sequences = kw.get("Sequences")
submitCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","submitCoils"), ofwhat=[ZSI.TC.String(pname="Sequences", aname="_Sequences", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitCoilsRequest, encoded="urn:Coils_Service")
class submitCoilsResponse:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
submitCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","submitCoilsResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitCoilsResponse, encoded="urn:Coils_Service")
class checkStatusCoilsRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
checkStatusCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","checkStatusCoils"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusCoilsRequest, encoded="urn:Coils_Service")
class checkStatusCoilsResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
checkStatusCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","checkStatusCoilsResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusCoilsResponse, encoded="urn:Coils_Service")
class getResultsCoilsRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
getResultsCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","getResultsCoils"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsCoilsRequest, encoded="urn:Coils_Service")
class getResultsCoilsResponse:
def __init__(self, **kw):
"""Keyword parameters:
CoiledCoils -- part CoiledCoils
"""
self._CoiledCoils = kw.get("CoiledCoils")
getResultsCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","getResultsCoilsResponse"), ofwhat=[ZSI.TC.String(pname="CoiledCoils", aname="_CoiledCoils", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsCoilsResponse, encoded="urn:Coils_Service")
class cancelCoilsRequest:
def __init__(self, **kw):
"""Keyword parameters:
JobId -- part JobId
"""
self._JobId = kw.get("JobId")
cancelCoilsRequest.typecode = Struct(pname=("urn:Coils_Service","cancelCoils"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelCoilsRequest, encoded="urn:Coils_Service")
class cancelCoilsResponse:
def __init__(self, **kw):
"""Keyword parameters:
Status -- part Status
"""
self._Status = kw.get("Status")
cancelCoilsResponse.typecode = Struct(pname=("urn:Coils_Service","cancelCoilsResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelCoilsResponse, encoded="urn:Coils_Service")
Coils_Service_client.pyc (binary file)
Coils_Service_types.py
################################################## # file: Coils_Service_types.py # # schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule" # /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/CoilsWS.wsdl # ################################################## import ZSI import ZSI.TCcompound from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED
control-seq001.Coils
1 M a 0.581 0.000 ( 0.000 1.976) 2 K a 0.855 0.000 ( 0.003 4.761) 3 K b 0.855 0.000 ( 0.003 4.761) 4 I c 0.855 0.000 ( 0.003 4.761) 5 T d 0.855 0.000 ( 0.003 4.761) 6 I e 0.855 0.000 ( 0.003 4.761) 7 Y a 0.876 0.000 ( 0.004 4.749) 8 D b 0.876 0.000 ( 0.004 4.749) 9 L c 0.876 0.000 ( 0.004 4.749) 10 A d 0.876 0.000 ( 0.004 4.749) 11 E e 0.876 0.000 ( 0.004 4.749) 12 L f 0.876 0.000 ( 0.004 4.749) 13 S g 0.876 0.000 ( 0.004 4.749) 14 G a 0.876 0.000 ( 0.004 4.749) 15 V b 0.876 0.000 ( 0.004 4.749) 16 S a 0.878 0.000 ( 0.004 4.744) 17 A b 0.878 0.000 ( 0.004 4.744) 18 S c 0.878 0.000 ( 0.004 4.744) 19 A a 0.881 0.000 ( 0.004 4.739) 20 V a 0.907 0.000 ( 0.006 4.642) 21 S b 0.907 0.000 ( 0.006 4.642) 22 A c 0.907 0.000 ( 0.006 4.642) 23 I a 0.993 0.000 ( 0.022 3.900) 24 L b 0.993 0.000 ( 0.022 3.900) 25 N c 0.993 0.000 ( 0.022 3.900) 26 G d 0.993 0.000 ( 0.022 3.900) 27 N a 1.080 0.001 ( 0.071 2.745) 28 W b 1.080 0.001 ( 0.071 2.745) 29 K c 1.080 0.001 ( 0.071 2.745) 30 K a 1.117 0.002 ( 0.111 2.253) 31 R b 1.117 0.002 ( 0.111 2.253) 32 R c 1.117 0.002 ( 0.111 2.253) 33 I d 1.117 0.002 ( 0.111 2.253) 34 S e 1.117 0.002 ( 0.111 2.253) 35 A f 1.117 0.002 ( 0.111 2.253) 36 K g 1.117 0.002 ( 0.111 2.253) 37 L a 1.117 0.002 ( 0.111 2.253) 38 A b 1.117 0.002 ( 0.111 2.253) 39 E c 1.117 0.002 ( 0.111 2.253) 40 K d 1.117 0.002 ( 0.111 2.253) 41 V e 1.117 0.002 ( 0.111 2.253) 42 T f 1.117 0.002 ( 0.111 2.253) 43 R g 1.117 0.002 ( 0.111 2.253) 44 I a 1.117 0.002 ( 0.111 2.253) 45 A b 1.117 0.002 ( 0.111 2.253) 46 E c 1.117 0.002 ( 0.111 2.253) 47 E d 1.117 0.002 ( 0.111 2.253) 48 Q e 1.117 0.002 ( 0.111 2.253) 49 G f 1.117 0.002 ( 0.111 2.253) 50 Y g 1.117 0.002 ( 0.111 2.253) 51 A c 1.043 0.001 ( 0.044 3.260) 52 I d 1.043 0.001 ( 0.044 3.260) 53 N e 1.043 0.001 ( 0.044 3.260) 54 R f 1.043 0.001 ( 0.044 3.260) 55 Q g 1.043 0.001 ( 0.044 3.260) 56 A a 1.022 0.000 ( 0.033 3.538) 57 S b 1.022 0.000 ( 0.033 3.538) 58 M c 1.022 0.000 ( 0.033 3.538) 59 L d 1.022 0.000 ( 0.033 3.538) 60 R e 1.022 0.000 ( 0.033 3.538) 61 S f 1.022 0.000 ( 0.033 3.538) 62 K g 1.022 0.000 ( 0.033 3.538) 63 K e 0.954 0.000 ( 0.013 4.309) 64 S f 0.954 0.000 ( 0.013 4.309) 65 H g 0.954 0.000 ( 0.013 4.309) 66 V d 0.796 0.000 ( 0.001 4.546) 67 I e 0.796 0.000 ( 0.001 4.546) 68 G f 0.796 0.000 ( 0.001 4.546) 69 M g 0.796 0.000 ( 0.001 4.546) 70 I a 0.713 0.000 ( 0.000 3.731) 71 I a 0.828 0.000 ( 0.002 4.708) 72 P b 0.828 0.000 ( 0.002 4.708) 73 K c 0.828 0.000 ( 0.002 4.708) 74 Y d 0.828 0.000 ( 0.002 4.708) 75 D e 0.828 0.000 ( 0.002 4.708) 76 N f 0.828 0.000 ( 0.002 4.708) 77 R g 0.828 0.000 ( 0.002 4.708) 78 Y a 0.828 0.000 ( 0.002 4.708) 79 F b 0.828 0.000 ( 0.002 4.708) 80 G c 0.828 0.000 ( 0.002 4.708) 81 S d 0.828 0.000 ( 0.002 4.708) 82 I a 0.880 0.000 ( 0.004 4.741) 83 A b 0.880 0.000 ( 0.004 4.741) 84 E c 0.880 0.000 ( 0.004 4.741) 85 R d 0.880 0.000 ( 0.004 4.741) 86 F e 0.880 0.000 ( 0.004 4.741) 87 E f 0.880 0.000 ( 0.004 4.741) 88 E g 0.880 0.000 ( 0.004 4.741) 89 M a 0.880 0.000 ( 0.004 4.741) 90 A b 0.880 0.000 ( 0.004 4.741) 91 R c 0.880 0.000 ( 0.004 4.741) 92 E d 0.880 0.000 ( 0.004 4.741) 93 R e 0.880 0.000 ( 0.004 4.741) 94 G f 0.880 0.000 ( 0.004 4.741) 95 L g 0.880 0.000 ( 0.004 4.741) 96 L a 0.880 0.000 ( 0.004 4.741) 97 P b 0.880 0.000 ( 0.004 4.741) 98 I a 1.044 0.001 ( 0.045 3.242) 99 I b 1.044 0.001 ( 0.045 3.242) 100 T c 1.044 0.001 ( 0.045 3.242) 101 C d 1.044 0.001 ( 0.045 3.242) 102 T e 1.044 0.001 ( 0.045 3.242) 103 R f 1.044 0.001 ( 0.045 3.242) 104 R g 1.044 0.001 ( 0.045 3.242) 105 R a 1.044 0.001 ( 0.045 3.242) 106 P b 1.044 0.001 ( 0.045 3.242) 107 E c 1.044 0.001 ( 0.045 3.242) 108 L d 1.044 0.001 ( 0.045 3.242) 109 E e 1.044 0.001 ( 0.045 3.242) 110 I f 1.044 0.001 ( 0.045 3.242) 111 E g 1.044 0.001 ( 0.045 3.242) 112 A a 1.044 0.001 ( 0.045 3.242) 113 V b 1.044 0.001 ( 0.045 3.242) 114 K c 1.044 0.001 ( 0.045 3.242) 115 A d 1.044 0.001 ( 0.045 3.242) 116 M e 1.044 0.001 ( 0.045 3.242) 117 L f 1.044 0.001 ( 0.045 3.242) 118 S g 1.044 0.001 ( 0.045 3.242) 119 W f 0.821 0.000 ( 0.001 4.680) 120 Q g 0.821 0.000 ( 0.001 4.680) 121 V a 0.821 0.000 ( 0.001 4.680) 122 D b 0.821 0.000 ( 0.001 4.680) 123 W c 0.821 0.000 ( 0.001 4.680) 124 V d 0.821 0.000 ( 0.001 4.680) 125 V e 0.821 0.000 ( 0.001 4.680) 126 A f 0.821 0.000 ( 0.001 4.680) 127 T g 0.821 0.000 ( 0.001 4.680) 128 G f 0.712 0.000 ( 0.000 3.718) 129 A g 0.712 0.000 ( 0.000 3.718) 130 T g 0.709 0.000 ( 0.000 3.679) 131 N d 0.657 0.000 ( 0.000 2.981) 132 P e 0.657 0.000 ( 0.000 2.981) 133 D f 0.657 0.000 ( 0.000 2.981) 134 K g 0.657 0.000 ( 0.000 2.981) 135 I a 0.657 0.000 ( 0.000 2.981) 136 S b 0.657 0.000 ( 0.000 2.981) 137 A c 0.657 0.000 ( 0.000 2.981) 138 L d 0.657 0.000 ( 0.000 2.981) 139 C e 0.657 0.000 ( 0.000 2.981) 140 Q f 0.657 0.000 ( 0.000 2.981) 141 Q g 0.657 0.000 ( 0.000 2.981) 142 A d 0.545 0.000 ( 0.000 1.549) 143 G e 0.545 0.000 ( 0.000 1.549) 144 V f 0.545 0.000 ( 0.000 1.549) 145 P g 0.545 0.000 ( 0.000 1.549) 146 T c 0.542 0.000 ( 0.000 1.512) 147 V d 0.542 0.000 ( 0.000 1.512) 148 N e 0.542 0.000 ( 0.000 1.512) 149 L f 0.542 0.000 ( 0.000 1.512) 150 D g 0.542 0.000 ( 0.000 1.512) 151 L c 0.537 0.000 ( 0.000 1.454) 152 P d 0.537 0.000 ( 0.000 1.454) 153 G e 0.537 0.000 ( 0.000 1.454) 154 S f 0.537 0.000 ( 0.000 1.454) 155 L g 0.537 0.000 ( 0.000 1.454) 156 S a 0.554 0.000 ( 0.000 1.645) 157 P a 0.677 0.000 ( 0.000 3.251) 158 S b 0.677 0.000 ( 0.000 3.251) 159 V c 0.677 0.000 ( 0.000 3.251) 160 I a 0.824 0.000 ( 0.002 4.691) 161 S a 0.867 0.000 ( 0.003 4.759) 162 D b 0.867 0.000 ( 0.003 4.759) 163 N c 0.867 0.000 ( 0.003 4.759) 164 Y d 0.867 0.000 ( 0.003 4.759) 165 G e 0.867 0.000 ( 0.003 4.759) 166 G f 0.867 0.000 ( 0.003 4.759) 167 A g 0.867 0.000 ( 0.003 4.759) 168 K a 0.867 0.000 ( 0.003 4.759) 169 A b 0.867 0.000 ( 0.003 4.759) 170 L c 0.867 0.000 ( 0.003 4.759) 171 T d 0.867 0.000 ( 0.003 4.759) 172 H e 0.867 0.000 ( 0.003 4.759) 173 K f 0.867 0.000 ( 0.003 4.759) 174 I g 0.867 0.000 ( 0.003 4.759) 175 L a 0.867 0.000 ( 0.003 4.759) 176 A b 0.867 0.000 ( 0.003 4.759) 177 N c 0.867 0.000 ( 0.003 4.759) 178 S d 0.867 0.000 ( 0.003 4.759) 179 A e 0.867 0.000 ( 0.003 4.759) 180 R f 0.867 0.000 ( 0.003 4.759) 181 R g 0.867 0.000 ( 0.003 4.759) 182 R e 0.839 0.000 ( 0.002 4.737) 183 G f 0.839 0.000 ( 0.002 4.737) 184 E g 0.839 0.000 ( 0.002 4.737) 185 L f 0.812 0.000 ( 0.001 4.637) 186 A g 0.812 0.000 ( 0.001 4.637) 187 P g 0.790 0.000 ( 0.001 4.505) 188 L f 0.752 0.000 ( 0.000 4.177) 189 T g 0.752 0.000 ( 0.000 4.177) 190 F a 0.695 0.000 ( 0.000 3.501) 191 I b 0.695 0.000 ( 0.000 3.501) 192 G c 0.695 0.000 ( 0.000 3.501) 193 G d 0.695 0.000 ( 0.000 3.501) 194 R e 0.695 0.000 ( 0.000 3.501) 195 R f 0.695 0.000 ( 0.000 3.501) 196 A g 0.695 0.000 ( 0.000 3.501) 197 T g 0.600 0.000 ( 0.000 2.210) 198 I a 0.600 0.000 ( 0.000 2.210) 199 T b 0.600 0.000 ( 0.000 2.210) 200 P c 0.600 0.000 ( 0.000 2.210) 201 A d 0.600 0.000 ( 0.000 2.210) 202 S a 0.618 0.000 ( 0.000 2.448) 203 V b 0.618 0.000 ( 0.000 2.448) 204 Y c 0.618 0.000 ( 0.000 2.448) 205 A d 0.618 0.000 ( 0.000 2.448) 206 A e 0.618 0.000 ( 0.000 2.448) 207 S f 0.618 0.000 ( 0.000 2.448) 208 T g 0.618 0.000 ( 0.000 2.448) 209 M a 0.618 0.000 ( 0.000 2.448) 210 R b 0.618 0.000 ( 0.000 2.448) 211 I c 0.618 0.000 ( 0.000 2.448) 212 A d 0.618 0.000 ( 0.000 2.448) 213 S e 0.618 0.000 ( 0.000 2.448) 214 W f 0.618 0.000 ( 0.000 2.448) 215 G g 0.618 0.000 ( 0.000 2.448) 216 L a 0.618 0.000 ( 0.000 2.448) 217 A b 0.618 0.000 ( 0.000 2.448) 218 C c 0.618 0.000 ( 0.000 2.448) 219 R d 0.618 0.000 ( 0.000 2.448) 220 R e 0.618 0.000 ( 0.000 2.448) 221 R f 0.618 0.000 ( 0.000 2.448) 222 I g 0.618 0.000 ( 0.000 2.448) 223 F a 0.596 0.000 ( 0.000 2.166) 224 W b 0.596 0.000 ( 0.000 2.166) 225 L a 0.747 0.000 ( 0.000 4.116) 226 P b 0.747 0.000 ( 0.000 4.116) 227 A c 0.747 0.000 ( 0.000 4.116) 228 I d 0.747 0.000 ( 0.000 4.116) 229 R e 0.747 0.000 ( 0.000 4.116) 230 K a 0.814 0.000 ( 0.001 4.650) 231 A b 0.814 0.000 ( 0.001 4.650) 232 T c 0.814 0.000 ( 0.001 4.650) 233 L d 0.814 0.000 ( 0.001 4.650) 234 R e 0.814 0.000 ( 0.001 4.650) 235 T f 0.814 0.000 ( 0.001 4.650) 236 A g 0.814 0.000 ( 0.001 4.650) 237 C a 0.814 0.000 ( 0.001 4.650) 238 R b 0.814 0.000 ( 0.001 4.650) 239 S c 0.814 0.000 ( 0.001 4.650) 240 G d 0.814 0.000 ( 0.001 4.650) 241 L e 0.814 0.000 ( 0.001 4.650) 242 A f 0.814 0.000 ( 0.001 4.650) 243 A g 0.814 0.000 ( 0.001 4.650) 244 R a 0.814 0.000 ( 0.001 4.650) 245 R b 0.814 0.000 ( 0.001 4.650) 246 R c 0.814 0.000 ( 0.001 4.650) 247 C d 0.814 0.000 ( 0.001 4.650) 248 C e 0.814 0.000 ( 0.001 4.650) 249 R f 0.814 0.000 ( 0.001 4.650) 250 G g 0.814 0.000 ( 0.001 4.650) 251 Y d 0.723 0.000 ( 0.000 3.846) 252 L e 0.723 0.000 ( 0.000 3.846) 253 L f 0.723 0.000 ( 0.000 3.846) 254 T g 0.723 0.000 ( 0.000 3.846) 255 R e 0.643 0.000 ( 0.000 2.790) 256 R f 0.643 0.000 ( 0.000 2.790) 257 Y g 0.643 0.000 ( 0.000 2.790) 258 P g 0.532 0.000 ( 0.000 1.409) 259 W d 0.490 0.000 ( 0.000 1.008) 260 K e 0.490 0.000 ( 0.000 1.008) 261 G f 0.490 0.000 ( 0.000 1.008) 262 L g 0.490 0.000 ( 0.000 1.008) 263 C a 0.476 0.000 ( 0.000 0.898) 264 A b 0.476 0.000 ( 0.000 0.898) 265 G c 0.476 0.000 ( 0.000 0.898) 266 C d 0.476 0.000 ( 0.000 0.898) 267 R e 0.476 0.000 ( 0.000 0.898) 268 R f 0.476 0.000 ( 0.000 0.898) 269 W g 0.476 0.000 ( 0.000 0.898) 270 V g 0.368 0.000 ( 0.000 0.305)
gbiowstest-coils.py
#!/usr/bin/env python
# ================================================================================
#
# COPYRIGHT NOTICE
#
# Centre National de la Recherche Scientifique
# CNRS
#
# Institut de Biologie et Chimie des Proteines
# IBCP CNRS UMR 5086
# 7 passage du Vercors
# 69007 Lyon, FRANCE
#
# This software/database is covered by copyright of CNRS IBCP
# All rights reserved. Reproduction and usage of this software/database are
# strictly restricted, and need a prior written permission from CNRS IBCP
# (see "Contact" below).
#
# CNRS IBCP do not and cannot warrant the performance or results that
# may be obtained by using this software or data. CNRS IBCP disclaim all
# warranties, express or implied, including warranties of performance,
# merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date: 18/11/2008
#
# $Revision: 1.0 $
#
# File Description:
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date Name Description of modification
# ------- ---------- -----------------------------------------------------
#
# ================================================================================
import sys
import time
from Coils_Service_client import *
fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.Coils'
ret = 0
# get a port proxy instance
loc = Coils_ServiceLocator()
port = loc.getCoilsPort()
###
# submit a new request
# create
req = submitCoilsRequest()
fp_input = open (fn_input, 'r')
req._Sequences = fp_input.read()
# call the remote method
resp = port.submitCoils(req)
jobid = resp._JobId
#print jobid
if not jobid:
ret = 1
###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusCoilsRequest()
req._JobId = jobid
while status not in ('done','aborted'):
time.sleep(2)
resp = port.checkStatusCoils(req)
status = resp._Status
#print status
if status != 'done':
ret = 1
###
# get results
req = getResultsCoilsRequest()
req._JobId = jobid
resp = port.getResultsCoils(req)
# write result
#open(fn_control,'w').write(resp._CoiledCoils)
#compare result with ref
resultcontrol = open(fn_control, 'r').read()
if resp._CoiledCoils != resultcontrol:
ret = 1
#print "wooohh"
#print ret
sys.exit (ret)
»
- Login to post comments