mprap test

This is a test of the mprap service.
Test filesDownload the files for this test
Test runRun test now
Support reference#2803-2804
Predicts the relative surface accessibility of a test sequence.
Show/hide recent test logs
view log 6 days agoPASSED

Test began: 2012-05-12 21:03:40 Test ended: 2012-05-12 21:05:06 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 2 weeks agoPASSED

Test began: 2012-05-08 04:04:32 Test ended: 2012-05-08 04:05:39 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 2 weeks agoPASSED

Test began: 2012-05-05 18:29:39 Test ended: 2012-05-05 18:31:05 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 3 weeks agoPASSED

Test began: 2012-04-27 21:28:58 Test ended: 2012-04-27 21:30:25 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 4 weeks agoPASSED

Test began: 2012-04-19 06:23:26 Test ended: 2012-04-19 06:24:28 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 1 month agoPASSED

Test began: 2012-04-17 19:41:07 Test ended: 2012-04-17 19:42:10 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 1 month agoPASSED

Test began: 2012-04-17 02:02:40 Test ended: 2012-04-17 02:03:41 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 1 month agoPASSED

Test began: 2012-04-15 18:28:43 Test ended: 2012-04-15 18:29:47 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 1 month agoPASSED

Test began: 2012-04-10 08:42:45 Test ended: 2012-04-10 08:43:47 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
view log 1 month agoPASSED

Test began: 2012-04-09 00:22:39 Test ended: 2012-04-09 00:23:46 Result : Test passed ------ stderr and stdout follow ------ 0Download this log...
This test consists of the following files:
test.mprap.soap.pl
#!/usr/bin/perl -w
use SOAP::Lite;
my $soap_mprapService = SOAP::Lite
->uri('mprap')
->proxy('http://wsdl.sbc.su.se/cgi-bin/mprap.cgi');
my $seq =">foo\nMSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHP
FFGIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFW
SIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFW
VKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI\n";
#print "runmprapSOAPDefault:\n";
my $result = $soap_mprapService -> runmprapDefault($seq);
# check for error
unless ($result->fault)
{
# Success! print the result
# check for error
my $output_str = $result->result();
if (
($output_str =~ /^\>mpRAP\_bin/) and
($output_str =~ /\>mpRAP\_real/) and
($output_str =~ /X\_X\_X\_X\_44/)){ #44 is specific for test sequence
print "0\n"; #output OK\n";
}
else{
print "1\n"; #output not OK\n";
}
#print $result->result();
#print "\n";
}
else
{
# report error code
print join ', ',
$result->faultcode,
$result->faultstring,
$result->faultdetail;
}
»
- Login to post comments